Navigation LinksBiology NewsHealth NewsBiology TechnologyMedicine Technology


We're sorry, that page (http://www.bio-medicine.org/q/ultrasound/) was not found.

Search q ultrasound at Google

Search q ultrasound at Yahoo

Search q ultrasound at Bing

Google
 
(Date:6/14/2019)... ... June 14, 2019 , ... Molecular diagnostics segment is the fastest-growing ... million in 2019. Major segments that are expected to drive the growth are ... and forecasted as segments in Kalorama’s The World Molecular Diagnostics Market, 8th Edition ...
(Date:6/6/2019)... ... June 05, 2019 , ... MedTech ... the global health and medical technology market, announced that it has selected Medacta ... Robotics Solution” award in the 2019 MedTech Breakthrough Awards program. , ...
(Date:6/4/2019)... ... June 04, 2019 , ... Harper was three years old when her ... elbow dysplasia, which caused painful osteoarthritis in the joints. She was referred to ... heartbroken. , The surgical specialist, Dr. Christopher Eich of Southern California Veterinary Specialty ...
Breaking Biology News(10 mins):
(Date:7/17/2019)... ... 16, 2019 , ... A medical home care program found that having a ... better care for seniors. While this may not sound surprising, a recent two year ... Brandman Research Institute (BRI) uncovered several surprising outcomes based on a simple formatted healthcare ...
(Date:7/13/2019)... ... July 13, 2019 , ... ZALO , the ... and innovative rechargeable vibrator and clitoral massager. To view the product and its accompanying ... newest and most advanced, personal massagers to people around the world,” said Mara Epstein, ...
(Date:7/13/2019)... ... , ... China Focus @ Bio Philadelphia , hosted ... Investment Promotion Bureau, Fox Rothschild LLP, MORE Health and Henlius, was held at ... WuXi Biologics, Kelun Pharmaceutical, Harbin Pharmaceuticals, Fountain Medical, Luye Life Science, Johnson&Johnson, Novartis, ...
(Date:7/11/2019)... ... July 11, 2019 , ... Swagelok Southeast ... of its territory through the acquisition of another Houston-area distributor. The acquisition of ... three facilities located in LaPorte, Nederland and Houston. , With this expansion, ...
(Date:7/10/2019)... N.C. (PRWEB) , ... July 10, 2019 , ... ... (NYSE American: YCBD), has just announced that Olympians Lolo Jones and Kerri Walsh ... platform for cbdMD to provide CBD education and brand awareness to athletes, fans, ...
Breaking Medicine News(10 mins):
... monoclonal antibody raised against a partial recombinant MAK. ... a.a. ~ 457 a.a) partial recombinant protein with ... PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 ... OMIM: 154235, ...
Mouse monoclonal antibody raised against a partial recombinant L3MBTL2. NCBI Entrez Gene ID = L3MBTL2...
Mouse polyclonal antibody raised against a partial recombinant QPCT. NCBI Entrez Gene ID = 25797...
Mouse monoclonal antibody raised against a partial recombinant CENTB2. NCBI Entrez Gene ID = CENTB2...
Biology Products:
Used for the retrieval of stones, stents, or other objects in the urinary tract under direct vision. Retrieval Forceps are designed for use through rigid or flexible endoscopes. Supplied sterile in p...
... dexterity in stone retrieval. SurLok graspers ... release easily, while the unique locking ... three- or four-pronged hook design gives ... These graspers securely attach to the ...
... grasping technology allows the ... in a shorter length ... to the stone. The ... ergonomic one-handed operation. Supplied ...
... The ACMI RiteCut Right Angle Cutting ... is used with a general purpose ... for use with any ACMI rigid, ... cystoscope which has a working channel ...
Medicine Products:
(Date:6/11/2019)... ... June 11, 2019 , ... Mytonomy, the ... national leader in opioid treatment, announced today they are partnering to combat the ... recently deployed its virtual care platform at the Mayo Clinic to drive shared ...
(Date:6/6/2019)... ... ... WCCT Global, Inc ., a full-service early phase contract research organization (CRO) ... 3 awards at the 2019 CRO Leadership Awards, to be held on June 24, ... Quality and Compatibility (Access to desired markets, cultural fit, timely project communications etc.) and ...
(Date:5/31/2019)... ... May 30, 2019 , ... World ... Integrity on July 08-09, 2019 in Boston, MA. This peer recommended interactive workshop ... organizations. , The training will kick off with a compendial treatment of Data ...
(Date:5/22/2019)... ... May 22, 2019 , ... Artemis (formerly Agrilyst), the leading enterprise ... funding round co-led by Astanor Ventures and Talis Capital with ... iSelect Fund . The company has raised $11.75m to date and will use ...
Breaking Biology Technology:
(Date:7/17/2019)... ... July 17, 2019 , ... ... solution needed to attract new customers, better engage existing patients and collaborate with ... digital marketing services in tandem with an all-in-one platform. With the Updox approach, ...
(Date:7/17/2019)... ... July 17, 2019 , ... Cognition Corporation , a ... a new e-book on developing user needs for life science products. , ... small part of the compliance process and the guiding force for product design. ...
(Date:7/17/2019)... , ... July 16, 2019 , ... ... by Medical Marketing & Media (MM&M) for its excellence in healthcare-professional marketing and ... Healthcare Professional Media Brand, (2) Best Marketing Team, (3) Best Young Marketer , ...
Breaking Medicine Technology: