Navigation Links

Biology News

Industrial Security Systems Market Worth $38 Billion by 2020

11/21/2014
DALLAS , November 18, 2014 According to a new market research report "Industrial Security Systems Market by Systems (Video, RFID, Access Control, Intrusion Detection, Parking Management, Under Vehicle Inspection), End Users (SEZ, Factories, Hotels, Banks, Government), Component Service Geography - Global Forecasts to 2020", published by MarketsandMarkets, The Industrial Secu... [Comments]

Patented Biosensor Wearable Technology Provides a More Civilized Method of Quarantine

11/21/2014
NEW YORK , Nov. 19, 2014  Earlier this year Donald Spector , Chairman of the Board at New York College, and one of the most prolific inventors in the world, got a patent for biosensor signals that are transmitted from Smartphones to third party agencies. Spector envisioned this technology even before there were Smartphones and has one of the earliest known patents in this... [Comments]

Gesture Recognition Intensifies with the Rise of In-car Smartphone Integration, Says Frost & Sullivan

11/21/2014
MOUNTAIN VIEW, Calif. , Nov. 20, 2014 Strict laws against distracted driving and the need for higher driver efficiency are piloting the North American and European automotive sector towards gesture recognition technologies. With the number of accidents growing, gesture recognition systems that are intuitive and able to retrieve information with ease will make a mark in the ind... [Comments]

C-Labs Names Former Microsoft and Bsquare Executive as Chief Operating Officer

11/21/2014
REDMOND, Wash. , Nov. 20, 2014 C-Labs LLC, a leading provider of remote and mobile access for the Internet of Things (IoT), today announced the appointment of John Traynor to the position of chief operating officer. Previously a strategic advisor to the firm, Mr. Traynor will now oversee sales, marketing, finance, and operations. Mr. Traynor is based out of the C-Labs office... [Comments]

Atmel Launches Industry's First Wide-V(cc) Low-Power Temperature Sensor Family

11/21/2014
SAN JOSE, Calif. , Nov. 20, 2014   Atmel® Corporation (NASDAQ: ATML ), a global leader in microcontroller (MCU) and touch technology solutions, today launched the industry's first family of high-precision digital temperature sensors with the widest V cc range from 1.7V to 5.5V. The new family delivers higher temperature accuracy and faster I 2 C bus communicatio... [Comments]

Identity Management, Document Authentication and Biometric Companies Form "The Airport Entry and Exit Working Group", Releasing the Framework to Help Guide the Department of Homeland Security and Congress Towards Solutions

11/18/2014
WASHINGTON , Nov. 18, 2014  The Secure Identity & Biometrics Association (SIBA) and the Security Industry Association today jointly announce the formation of The Airport Entry and Exit Working Group and release of its Identity and Biometric Entry and Exit Solutions Framework for Airports (Framework). The Framework received official support from BORDERPOL, the interna... [Comments]

Partners HealthCare and EMC Unite to Solve Health Care's Toughest Challenges Using Big Data

11/18/2014
BOSTON , Nov. 17, 2014   News Highlights: Partners HealthCare and EMC collaborate to develop The Partners Data Lake, an agile data and analytics platform The Partners Data Lake will allow researcher and clinicians to explore and develop insight to improve diagnostics, treatment and the lives of patients The Partners Data Lake will support research and clinical... [Comments]

FDA's Janet Woodcock, EMA's Emer Cooke Headline PDA Quality Metrics Conference

11/18/2014
BETHESDA, Md. , Nov. 17, 2014 The Parenteral Drug Association (PDA) today confirmed that seven officials from European and U.S. regulatory agencies will speak and at least seven more will participate in the upcoming 2014 PDA Pharmaceutical Quality Metrics Conference at the Omni Shoreham Hotel in Washington D.C. , Dec. 2-4. "PDA is pleased once again to have sig... [Comments]

Biology Products

Mouse Anti-Snail, a.a. 150-39 Antibody, Unconjugated from CHEMICON

Description:Snail, a.a. 150-39...
Company:CHEMICON

Rat Anti-Mouse IgM Heavy Chain Monoclonal Antibody, Unconjugated, Clone LO-MM-3 from Cell Sciences

Description:Anti-Mouse IgM Heavy Chain, Clone LO-MM-3, Monoclonal Antibody...
Company:Cell Sciences

Chicken Anti-HOXC11 Polyclonal Antibody, Unconjugated from ProSci, Inc

Description:HOXC11 Antibody...
Company:ProSci, Inc

Rabbit Anti-BAFF-R (CT) BR3 Polyclonal Antibody, Unconjugated from ProSci, Inc

Description:BAFF-R (CT) BR3 Affinity Purified Polyclonal Antibody...
Company:ProSci, Inc

Chicken Anti-HOXC11 Polyclonal Antibody, Unconjugated from ProSci, Inc

Description:HOXC11 Antibody...
Company:ProSci, Inc

Biology Technology

Apiscent Labs Launches New Website

11/23/2014
St. Francis, WI (PRWEB) November 23, 2014 Apiscent Labs, a privately held U.S. based manufacturer and supplier of fine chemical ingredients to the global pharmaceutical and flavor & fragrance industries announced the launch of its new website, Apiscent.com. The Apiscent.com homepage welcomes visitors with a description of Apiscent Labs, clean design, easy navigation, rotating images... [Comments]

DrugDev Webinars in December to Explore What Comes Next for ALS Research and How We Can Make Life Easier for Clinical Sites

11/22/2014
Audubon, PA and London (PRWEB) November 21, 2014 Two new educational webinars hosted by DrugDev in December will explore what comes next for ALS research and how the pharmaceutical industry can make life easier for clinical sites. After the Ice Bucket Challenge: Where Does the ALS Money Go? Featuring guest speaker Dr. Merit Cudkowicz Date: Tuesday, 2 December 2014 Time: 1:30p... [Comments]

Sherry Sharp, Wife of CarMax Founder, Richard Sharp, Accepts Seat on Board of Cure Alzheimer’s Fund

11/22/2014
Richmond, VA (PRWEB) November 21, 2014 During his lifetime Richard L. Sharp was a pioneering businessman who understood the need to surround himself with great people and take risks to achieve success. A visionary, CEO and entrepreneur, his friends often marveled at his extraordinarily courageous attitude when taking on challenges. That’s how he lived his life and -- even with his death imp... [Comments]

Pioneering Academics and Key Industry Leaders to Discuss Rare Diseases and the Emergence of New Genetic Medicines at Genetic Rx on December 3rd

11/22/2014
Boston, MA (PRWEB) November 21, 2014 Prominent academics, leaders of the biopharmaceutical industry and key investors will gather on December 3rd at Genetic Rx, a networking conference of the Boston Biotech Conferences series. GeneticRx will take place at the Joseph B. Martin Conference Center at Harvard Medical School and will discuss the present and future of genetic medicines—including s... [Comments]

CannLabs Secures $750,000 Line Of Credit

11/22/2014
Denver, Colo. (PRWEB) November 21, 2014 CannLabs, Inc. (OTCQB: CANL), the leading provider of proprietary cloud based analytics and scientific testing methodologies relating to cannabis, today announced that it has received a commitment for a $750,000 line of credit from an existing stockholder of the Company. “We are extremely pleased to have secured this commitment from one of our e... [Comments]

(Date:11/6/2014)... 6, 2014 - Insilico Medicine, Inc, a Baltimore-based ... age related diseases announced a research collaboration with ... Champions Oncology, Inc (OTC: CSBR). , "There are ... medicine, but Champions Oncology,s TumorGraft technology is unique ... chemotherapy regimen experimentally generating vast amounts of valuable ...
(Date:11/5/2014)... Kelly Redmond has dedicated his career to understanding ... a general audience. , As deputy director and ... at Nevada,s Desert Research Institute, Redmond has more ... application and dissemination of climate data to the ... Meeting in San Francisco on December 15-19, 2014 ...
(Date:11/4/2014)... LAKE CITY, Nov. 5, 2014 – University of Utah ... enzymes to help jet fuel produce electricity without needing ... be used to power portable electronics, off-grid power and ... online today in the American Chemical Society journal ... electricity through a chemical reaction between a fuel and ...
Breaking Biology News(10 mins):Insilico Medicine, Inc announces research collaboration with Champions Oncology, Inc 2Nevada climatologist to be honored at AGU Fall Meeting for lifetime of public outreach 2Jet-fueled electricity at room temperature 2
... for the first time, how a potted plant,s roots are arranged ... be presented at the Society for Experimental Biology meeting on 30th ... makes plants grow over 40% larger. From their 3-D ... their roots to the pot,s walls. It is likely that the ...
... new batch of Geology papers posted online ... asynchrony; oceanic crust; sand budgets; the Alpine fault,s seismic ... weathering in the Critical Zone; giant wave ripples; the ... network; and soils as ledgers recording transactions of energy ...
... apart DNA that bears certain signature sequences is a defense ... can be a powerful research tool. With a newly discovered ... a targeted method of slicing DNA that they say can ... lab. Tools that snip apart DNA strands in defined ...
Cached Biology News:Sandy beaches, hydrocarbon reservoirs, tectonic tilting: It's all about geology 2Sandy beaches, hydrocarbon reservoirs, tectonic tilting: It's all about geology 3Sandy beaches, hydrocarbon reservoirs, tectonic tilting: It's all about geology 4Sandy beaches, hydrocarbon reservoirs, tectonic tilting: It's all about geology 5Sandy beaches, hydrocarbon reservoirs, tectonic tilting: It's all about geology 6Sandy beaches, hydrocarbon reservoirs, tectonic tilting: It's all about geology 7Sandy beaches, hydrocarbon reservoirs, tectonic tilting: It's all about geology 8Sandy beaches, hydrocarbon reservoirs, tectonic tilting: It's all about geology 9Sandy beaches, hydrocarbon reservoirs, tectonic tilting: It's all about geology 10Programmable RNA complex could speed genome editing in the lab 2Programmable RNA complex could speed genome editing in the lab 3
... a partial recombinant FES. ... 250 a.a) partial recombinant protein with GST ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: BC035357 ... AAH35357 OMIM: 190030, ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
... sufficient materials for 1,464 array sample elements. , , ... , Blocker BSA in PBS (10X): 50 ml ... BupH Phosphate Buffered Saline: 8 packs , 10% ... Pico Luminol Enhancer: 2 x 25 ml , SuperSignal ...
Biology Products:
(Date:11/22/2014)... 21, 2014   ... Commercial Officer zu KLOX    ... Chief Financial Officer bestellt    KLOX ... seines jüngst zugelassenen Behandlungssystems zur Wundheilung zu beginnen    ... "Unternehmen") ist sehr erfreut, die folgenden personellen Veränderungen anzukündigen: ...
(Date:11/21/2014)... BELLINGHAM, Washington, USA (PRWEB) November 19, 2014 ... used in our lives was shared with more than ... undergraduate and postgraduate students from the University of Otago ... Outreach Grant . The Otago students, members of the ... Southland New Zealand in early September, giving children from ...
(Date:11/21/2014)... 20, 2014 The California ... research organization representing leading California academic institutions, biotechnology, ... PwC US today released a report revealing ... industry growth. The trend shows a 4 percent ... California Biomedical Industry Report indicates that, while ...
(Date:11/21/2014)... Fayetteville, Arkansas (PRWEB) November 20, 2014 ... partners, Pinnacle Ozone Solutions, LLC (Pinnacle), and PCI, ... equipment, announced that they have been selected to ... City of Fayetteville, Arkansas Paul R. Noland Wastewater ... feature BlueInGreen’s patented HyDOZ® gas dissolution ...
Breaking Biology Technology:KLOX Technologies meldet Neubesetzung von Führungspositionen 2KLOX Technologies meldet Neubesetzung von Führungspositionen 3KLOX Technologies meldet Neubesetzung von Führungspositionen 4KLOX Technologies meldet Neubesetzung von Führungspositionen 5Optics and photonics outreach programs share science, spark fascination with light 2Optics and photonics outreach programs share science, spark fascination with light 3California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 2California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 3California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 4City of Fayetteville Leads Nation with Innovative Ozone Technology 2City of Fayetteville Leads Nation with Innovative Ozone Technology 3City of Fayetteville Leads Nation with Innovative Ozone Technology 4
... /PRNewswire-FirstCall/ - MIGENIX Inc.,(TSX: MGI; OTC: MGIFF), ... reports financial results for the three months ... its programs., UPDATE ON DRUG DEVELOPMENT ... cationic peptide;,prevention of catheter-related infections): A pivotal ...
... a Planned Phase II Study of ... Sclerosis, COPENHAGEN, Denmark, December 13 Genmab A/S,(OMX: ... study of,ofatumumab (HuMax-CD20(R)) for the treatment of relapsing remitting,multiple ... study which will be conducted under Genmab,s collaboration with,GlaxoSmithKline ...
... SAN FRANCISCO, Calif., Dec. 13 Anesiva,Inc. (Nasdaq: ... a common stock offering,of 11,111,111 shares of its ... discount to the closing bid price on December ... before deducting underwriting,discounts and commissions (approximately $50 million ...
Cached Biology Technology:MIGENIX Reports Second Quarter Fiscal Year 2008 Financial Results 2MIGENIX Reports Second Quarter Fiscal Year 2008 Financial Results 3MIGENIX Reports Second Quarter Fiscal Year 2008 Financial Results 4MIGENIX Reports Second Quarter Fiscal Year 2008 Financial Results 5MIGENIX Reports Second Quarter Fiscal Year 2008 Financial Results 6MIGENIX Reports Second Quarter Fiscal Year 2008 Financial Results 7MIGENIX Reports Second Quarter Fiscal Year 2008 Financial Results 8MIGENIX Reports Second Quarter Fiscal Year 2008 Financial Results 9MIGENIX Reports Second Quarter Fiscal Year 2008 Financial Results 10MIGENIX Reports Second Quarter Fiscal Year 2008 Financial Results 11MIGENIX Reports Second Quarter Fiscal Year 2008 Financial Results 12MIGENIX Reports Second Quarter Fiscal Year 2008 Financial Results 13MIGENIX Reports Second Quarter Fiscal Year 2008 Financial Results 14MIGENIX Reports Second Quarter Fiscal Year 2008 Financial Results 15MIGENIX Reports Second Quarter Fiscal Year 2008 Financial Results 16MIGENIX Reports Second Quarter Fiscal Year 2008 Financial Results 17MIGENIX Reports Second Quarter Fiscal Year 2008 Financial Results 18Genmab Announces Details of Planned Ofatumumab Phase II Study in Multiple Sclerosis 2Genmab Announces Details of Planned Ofatumumab Phase II Study in Multiple Sclerosis 3Anesiva Raises $45 Million in Common Stock Offering 2