Navigation Links
WTN Exclusive Interview: Cory L. Nettles, Secretary of Commerce

ad arsenal of honest incentives, which we can provide as deal sweeteners such as tax credits and access to low cost capital. The people we need to be working and partnering with, whether they are Wisconsin businesses, venture capitalists, or out of state industries are smart enough to take a hard look at what we do.

WTN: Recently, the Governor traveled to Eau Claire to award Silicon L......

Full article >>>
'"/>


Source:wistechnology.com By Mike Klein 03/17/03


Page: 1 2 3 4 5 6

Related biology technology :

1. Epics Founder Judy Faulkner Speaks on Culture, Business Beliefs, and Recruiting: WTN Exclusive Coverage
2. Exclusive Interview With Dick Leazer: Renaissance Man
3. Exclusive WTN Interview with Don Williamson
4. WTN Exclusive Interview with Josh Heling
5. Interview: Dr. William Yasnoff on health records, part 2
6. Interview: Dr. William Yasnoff on patient-centric IT
7. Interview: Dr. Barry Chaiken on healthcare IT
8. Interview: New commerce secretary wants to keep momentum on jobs and business programs
9. Interview: State CIO predicts small businesses and SOA will shape Wisconsin
10. WTN Interview: HHS Secretary calls for $550 million health care fund to reduce deaths caused by medical errors
11. WTN Interview: John Pulling, Provia Software
Hitting the Wal-Mart RFID Deadline

Post Your Comments:
*Name:
*Comment:
*Email:
TAG: WTN Exclusive Interview Cory Nettles Secretary Commerce

(Date:5/21/2015)... 2015 W. R. Grace & ... in Worms, Germany has received good manufacturing practice ... the International Pharmaceutical Excipient Council (IPEC) Foundation. ... its SYLOID® FP brand of pharmaceutical grade excipient ... the Curtis Bay, Maryland (USA) and Sorocaba, Brazil ...
(Date:5/21/2015)... 2015 Research and Markets ( ... "2015 Global Survey on Flow Cytometry Adoption ... The primary goal of this research is to ... reagents. Key information the survey seeks to collect ... cytometers, predominantly used applications for flow cytometers, respondents, ...
(Date:5/20/2015)... , May 20, 2015 Veracyte, ... preliminary data demonstrating the ability of the company,s ... (IPF) from other interstitial lung diseases (ILDs) using ... classifier,s potential to help thousands of patients avoid ... in IPF diagnosis – a frequent challenge for ...
(Date:5/20/2015)... Pa. , May 20, 2015  Select ... that the Federal Trade Commission granted early termination ... Antitrust Improvements Act of 1976, as amended, applicable ... MJ Acquisition Corporation, a joint venture that Select ... L.P. As previously announced, MJ Acquisition ...
Breaking Biology Technology:Grace European Facility Receives GMP Excipient Certification for SYLOID® FP Silica Gel 2Global Survey on Flow Cytometry Adoption Trends 2015 2Veracyte Presents Preliminary Data Demonstrating Ability of Molecular Classifier to Improve Non-Surgical IPF Diagnosis Using Bronchoscopy Samples 2Veracyte Presents Preliminary Data Demonstrating Ability of Molecular Classifier to Improve Non-Surgical IPF Diagnosis Using Bronchoscopy Samples 3Veracyte Presents Preliminary Data Demonstrating Ability of Molecular Classifier to Improve Non-Surgical IPF Diagnosis Using Bronchoscopy Samples 4Veracyte Presents Preliminary Data Demonstrating Ability of Molecular Classifier to Improve Non-Surgical IPF Diagnosis Using Bronchoscopy Samples 5Select Medical Corporation's Proposed Acquisition of Concentra Inc. through Joint Venture with Welsh Carson Receives Antitrust Clearance 2
... Whitewater, Wis. - The University of Wisconsin-Whitewater has ... what is now known as the Information Technology Infrastructure ... Computer End-User Technologies program, is a product of joint ... will begin this fall semester. It places a far ...
... Metavante Corp., the financial technology subsidiary of Marshall ... June, of Wayne, Pa.-based GHR Systems, Inc. , ... mortgage and consumer finance industries that offers point-of-sale products ... Systems will become a Metavante subsidiary. , ,GHR's client ...
... - Southern Wisconsin's biotech infrastructure has prompted a ... an operating facility that could employ approximately 200 people. ... the southern tier of Wisconsin to manufacture systems used ... CEO Dan Miller. It's a product that company representatives ...
Cached Biology Technology:Whitewater upgrades tech degree program 2Whitewater upgrades tech degree program 3Minneapolis company sets sights on southern Wisconsin 2Minneapolis company sets sights on southern Wisconsin 3
(Date:4/20/2015)... , April 20, 2015 ...   Glenbeigh Records Management (GRM), Ireland,s ... with Dubai Islamic Bank. Having built up an impressive track ... now a leading player within the records management sector in ... expects to double is GCC staffbase and employ a further ...
(Date:4/13/2015)... , April 13, 2015 ... TechSci Research, "Global Biometrics Market Forecast & Opportunities, 2020", ... a CAGR of around 14% till 2020. The ... for large scale implementation and review of biometric ... launch of new products with greater efficiency, are ...
(Date:4/8/2015)... CHARLOTTE, N.C. , April 8, 2015 /PRNewswire/ ... technology solutions and services, and Morpho, a leading ... in partnership to produce the market,s most advanced ... Infinisource,s iSolved NXG time clock is setting ... attendance and labor data for the small and ...
Breaking Biology News(10 mins):Glenbeigh Records Management Wins Contract With Dubai Islamic Bank 2Glenbeigh Records Management Wins Contract With Dubai Islamic Bank 3Global Biometrics Market to Cross US$ 21 Billion by 2020: TechSci Research 2iSolved Time Clock Offers Unmatched Accuracy due to Morpho Biometrics 2iSolved Time Clock Offers Unmatched Accuracy due to Morpho Biometrics 3
... and swift, viruses are hard to capture on video. Now ... a virus-like particle as it tries to break into and ... learn more about how to deliver drugs via nanoparticles ... well as how to prevent viral infection from occurring. ...
... a busy airport where cold viruses and other germs circulate ... bees and butterflies can pick up fungal, bacterial or viral ... as debilitating as influenza. But "almost nothing is ... postdoctoral researcher Scott McArt and Professor Lynn Adler at the ...
... Rett Syndrome Foundation (IRSF) announces today ten (10) new ... Translational Research Program; and additional funding for current human ... 2013 covers the spectrum of Rett syndrome research, from ... way to treating the girls diagnosed with Rett syndrome. ...
Cached Biology News:Now in 3-D: Video of virus-sized particle trying to enter cell 2Now in 3-D: Video of virus-sized particle trying to enter cell 3As hubs for bees and pollinators, flowers may be crucial in disease transmission 2IRSF announces 2013 awards and implements new Translational Program 2IRSF announces 2013 awards and implements new Translational Program 3
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... Mouse polyclonal antibody raised against a partial ... FES (AAH35357, 120 a.a. ~ 250 a.a) ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
... antibody raised against a partial ... Immunogen: PPP4C (NP_002711, 218 ... recombinant protein with GST tag. ... NM_002720 ...
Mouse monoclonal antibody raised against a partial recombinant CAPG. NCBI Entrez Gene ID = CAPG...
Biology Products: