Navigation Links
lifeIMAGE Announces No-Cost Service for Hospitals to Give Patients Secure Access to Medical Imaging, Pledges Support for the Blue Button Initiative
Date:3/1/2013

tive exams, excessive radiation, delayed care, and significant redundant costs.

For the past two years, lifeIMAGE has been working with Radiological Society of North America (RSNA) on a project funded by the National Institute for Biomedical Imaging and Bioengineering (NIBIB) to deploy XDS-based technologies that promote patient access to imaging records.

“Patients have been waiting for this for a long time and lifeIMAGE is very adept at providing solutions in this realm. I’m delighted to have commercial partners help expand the RSNA Image Share Network,” said Dr. David Mendelson, Principal Investigator of the Image Share Network, Co-Chair of Integrating the Healthcare Enterprise, and Chief of Clinical Informatics at Mount Sinai Medical Center.

Earlier this week, the Department of Radiology and Biomedical Imaging at the University of California, San Francisco, a pilot site of the RSNA Image Share project, published results of its survey conducted among physicians and patients 12 months after launching the electronic personal health record. The survey found that 95 percent of participating patients understand the importance of a patient-controlled imaging PHR, and 85 percent are very satisfied with the experience.

“Patients with acute and chronic illnesses typically see clinicians at more than one hospital or care setting—their local physician or hospital and often a specialist or two at a tertiary care facility. Health systems and physicians who help patients easily share their records with other care providers will deliver better care, avoid ex
'/>"/>

Source: PRWeb
Copyright©2012 Vocus, Inc.
All rights reserved

Page: 1 2 3

Related biology technology :

1. Keryx Biopharmaceuticals, Inc. Announces Upcoming Poster Presentations of Zerenex™ (Ferric Citrate) at the Upcoming American Society of Nephrology Kidney Week 2011 Annual Meeting
2. VaxyGen Assay Services, LLC Announces Launch of Custom Bioassay Services and Operations
3. Sequenom Announces Participation at the Lazard Capital Markets 8th Annual Healthcare Conference
4. ACORN Research, LLC Announces Partnership with AdeptBio, LLC
5. GeoVax Labs, Inc. Announces Nine Month 2011 Financial Results
6. WuXi PharmaTech Announces Third-Quarter 2011 Results
7. Chimerix Announces Late-Breaking Poster Presentation at Kidney Week 2011 Annual Meeting
8. Spherix Announces Third Quarter Financial Results
9. Modern Mobility Aids, Inc. Announces November 30, 2011 Closing of Lumigene Acquisition
10. MedImmune Announces Winners of Its 6th Annual Global Abstract Competition
11. Nile Therapeutics Announces Top-Line Results in Clinical Trial Evaluating the Subcutaneous Infusion of Cenderitide, Meets Primary Endpoint
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:3/25/2015)... March 25, 2015  The Technology Association of ... dedicated to the promotion and economic advancement of ... Health as one of its Top 40 Innovative Technology ... recognize this prestigious group at the 2015 Georgia Technology ... Galleria Centre. TAG,S Top 40 Awards recognize ...
(Date:3/25/2015)... 2015  18 piglets born recently are the ... scientists in the College of Agriculture and Natural Resources at ... in the field of genetic engineering. Bhanu Telugu, ... & Avian Sciences (ANSC) and Ki-Eun Park, PhD, ... genome-edited pigs using a recently developed, groundbreaking technique ...
(Date:3/25/2015)... Proove Biosciences , a commercial ... announce the success of their commercially supported symposium, ... Optimize the Management of Pain, at the 31st Annual ... Maryland on Thursday, March 19th, 2015. , ... Lynn Webster , M.D., former Florida Society of ...
(Date:3/25/2015)... March 25, 2015   Demy-Colton Life Science Advisors ... and business development conferences exclusively for the biopharmaceutical and ... the Biotech CEO Summit. The Biotech ... brings together biotech industry leaders who are united by ... while reaping the rewards of biotech,s new golden age. ...
Breaking Biology Technology:Streamline Health, Inc. Named a TAG Top 40 Innovative Technology Company 2Streamline Health, Inc. Named a TAG Top 40 Innovative Technology Company 3Streamline Health, Inc. Named a TAG Top 40 Innovative Technology Company 4University of Maryland Researchers Successfully Produce Genome-edited Pigs Using Revolutionary Technology 2Proove Biosciences Hosts Symposium on Incorporating Genetic Testing to Optimize the Management of Pain 2Biotech CEO Summit to Bring Key Biotech Leaders Together in Industry Brain Trust 2
... Fibrocell Science, Inc. (OTC Bulletin Board: FCSC) announced today ... U.S. Food and Drug Administration (FDA) related to the Biologics ... the treatment of moderate to severe nasolabial fold wrinkles in ... Center for Biologics Evaluation and Research (CBER) when the review ...
... , ANNAPOLIS, Md., Dec. 21 PharmAthene, Inc. (NYSE Amex: ... biological and chemical threats, today announced the appointment of Jeffrey ... Board to eight members. , Dr. Runge is a ... in business risk management, homeland security and homeland defense. ...
... , BOTHELL, WA and VANCOUVER, ... OGXI ) announced today that the Company will host a ... 21, 2009. , A live webcast will be available through ... http://ir.oncogenex.com . Alternatively, you may access the live conference ...
Cached Biology Technology:Fibrocell Science, Inc. Receives FDA Complete Response Letter Regarding azficel-T for Wrinkles 2PharmAthene Appoints Jeffrey W. Runge, M.D. to the Company's Board of Directors 2PharmAthene Appoints Jeffrey W. Runge, M.D. to the Company's Board of Directors 3OncoGenex Pharmaceuticals to Host Investor Conference Call at 8:30 a.m. ET, December 21, 2009 2
(Date:3/23/2015)... , Mar. 23, 2015 NXT-ID, Inc. (NASDAQ: NXTD ... on the growing mobile commerce market, announces its biometric payment ... campaign on CNBC television starting March 30 th . ... airing in New York markets. ... "We are excited about our new ad campaign following the ...
(Date:3/20/2015)... DUBLIN , Mar. 19, 2015 Research and Markets ... the "Hand Geometry - Global Strategic Business Report" ... worldwide markets for Hand Geometry in US$ Thousands. The report ... , Japan , Europe ... America , and Rest of World. Annual ...
(Date:3/20/2015)... Research and Markets ( http://www.researchandmarkets.com/research/vkzvcs/iris_biometrics ) has ... Strategic Business Report" report to their offering. ... US$ Thousands. The report provides separate comprehensive analytics for the ... , Europe , Asia-Pacific ... Latin America . Annual estimates and forecasts ...
Breaking Biology News(10 mins):NXT-ID's Wocket Smart Wallet to Launch New CNBC Regional TV Ad Campaign 2NXT-ID's Wocket Smart Wallet to Launch New CNBC Regional TV Ad Campaign 3Hand Geometry - Global Strategic Business Report 2015: An Essential Security Component for both Government & Enterprise Sector 2Hand Geometry - Global Strategic Business Report 2015: An Essential Security Component for both Government & Enterprise Sector 3Hand Geometry - Global Strategic Business Report 2015: An Essential Security Component for both Government & Enterprise Sector 4Iris Biometrics - Global Strategic Business Report 2015: System & Network Access Control - A Robust Market Opportunity in the Offing 2Iris Biometrics - Global Strategic Business Report 2015: System & Network Access Control - A Robust Market Opportunity in the Offing 3Iris Biometrics - Global Strategic Business Report 2015: System & Network Access Control - A Robust Market Opportunity in the Offing 4Iris Biometrics - Global Strategic Business Report 2015: System & Network Access Control - A Robust Market Opportunity in the Offing 5
... risk during cardiac procedures. Doctors performing heart surgery also ... IAEA is helping to raise awareness of threats, through ... X-ray imaging systems. The issue of radiation protection ... of lengthy angioplasty and other cardiac interventions performed under ...
... mainly because they lose control of their growth. To better ... University,s Comprehensive Cancer Center looks at four genes that help ... in adults. , The genes E2f1, E2f2, and E2f3a ... help control cell proliferation, a belief that comes from experiments ...
... the atomic bomb blasts in Hiroshima and Nagasaki, Japan, ... later developed papillary thyroid cancer as adults, according to ... of Cancer Research , a journal of the ... subjects who lived close to the blast sites, were ...
Cached Biology News:Protecting those who heal 2Location, location, location important for genes, too 2Researchers discover atomic bomb effect results in adult-onset thyroid cancer 2
... Mouse monoclonal antibody raised against a partial recombinant ... 56 a.a. ~ 145 a.a) partial recombinant protein ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... Buffer I can be used in intracellular ... permeabilize cells and to serve as an ... saponin-mediated cell permeabilization is a reversible process, ... in the presence of saponin during intracellular ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Biology Products: