Navigation Links
iBio Pharmaceutical Technology Embraced by the Government of Brazil
Date:6/24/2013

p>"The production process from the extraction plant is a novelty in the country. The technology ensures higher security than the biological produced from viruses and bacteria. It produces fewer side effects and less resistance facing the human body which receives the treatment. Moreover, it requires less investment."

"Ceara is very happy to help correct regional inequalities. It is the country's time to celebrate because we see investing in Brazil and seeing possibilities," said state governor Cid Gomes.

"Organic products are more effective compared to traditional medicines from chemical synthesis, increasing the chances of successful treatment especially for chronic diseases. They are made from living material and manufactured from processes involving personalized medicine and molecular biology."

"Currently biological resources represent 43% of the medicines used by the Ministry of Health, or about U.S. $ 4 billion per year."

Full text of the original Portuguese language article is available at this link: http://www.jornaldebrasilia.com.br/site/noticia.php?brasil-amplia-producao-de-medicamentos-biologicos&id=476955

About iBio, Inc.

iBio develops and offers product applications of its iBioLaunch and iBioModulator™ platforms, providing collaborators full support for turn-key implementation of its technology for both proprietary and biosimilar products. Additionally, iBio is developing select product candidates that have been derived from the iBioLaunch platform.  The iBioLaunch platform is a proprietary, transformative technology for development and production of biologics using transient gene expression in unmodified green plants.  The iBioModulator platform is complementary to the iBioLaunch platform and is designed to significantl
'/>"/>

SOURCE iBio, Inc.
Copyright©2012 PR Newswire.
All rights reserved

Page: 1 2 3

Related biology technology :

1. Piedmont Pharmaceuticals Gains FDA Approval of Animal Health Soft Chew Pain Medication
2. Innovative Drug Delivery Systems: Novel Product and Formulation Technology Licensing Opportunities for Generic Pharmaceutical Companies
3. North American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes Market - Forecast to 2017
4. Smart Consulting Group and The Catalyst Group Form Alliance to Supply Quality Compliance Consulting Services For the Pharmaceutical Industry
5. Frost & Sullivan Recognizes Sciformixs Continued Growth in the Increasingly Complex Pharmaceutical KPO Market
6. Auxilium Pharmaceuticals, Inc. To Present At The Goldman Sachs 34th Annual Global Healthcare Conference
7. BioConvergence® Launches New Blog Aimed at Exploring Best Practices of Pharmaceutical and Biotechnology Industries
8. Actinium Pharmaceuticals Acute Myeloid Leukemia Clinical Data to be Presented Today at 8th International Symposium on Targeted Alpha Therapy Conference
9. Isis Pharmaceuticals Earns $10 Million Milestone Payment from AstraZeneca for ISIS-AR Rx to Treat Prostate Cancer
10. GW Pharmaceuticals plc Reports 2013 Second Quarter Financial Results
11. Ohr Pharmaceutical to Present at the Marcum MicroCap Conference on May 30th
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:3/25/2015)... March 25, 2015  The Technology Association of ... dedicated to the promotion and economic advancement of ... Health as one of its Top 40 Innovative Technology ... recognize this prestigious group at the 2015 Georgia Technology ... Galleria Centre. TAG,S Top 40 Awards recognize ...
(Date:3/25/2015)... 2015  18 piglets born recently are the ... scientists in the College of Agriculture and Natural Resources at ... in the field of genetic engineering. Bhanu Telugu, ... & Avian Sciences (ANSC) and Ki-Eun Park, PhD, ... genome-edited pigs using a recently developed, groundbreaking technique ...
(Date:3/25/2015)... Proove Biosciences , a commercial ... announce the success of their commercially supported symposium, ... Optimize the Management of Pain, at the 31st Annual ... Maryland on Thursday, March 19th, 2015. , ... Lynn Webster , M.D., former Florida Society of ...
(Date:3/25/2015)... March 25, 2015   Demy-Colton Life Science Advisors ... and business development conferences exclusively for the biopharmaceutical and ... the Biotech CEO Summit. The Biotech ... brings together biotech industry leaders who are united by ... while reaping the rewards of biotech,s new golden age. ...
Breaking Biology Technology:Streamline Health, Inc. Named a TAG Top 40 Innovative Technology Company 2Streamline Health, Inc. Named a TAG Top 40 Innovative Technology Company 3Streamline Health, Inc. Named a TAG Top 40 Innovative Technology Company 4University of Maryland Researchers Successfully Produce Genome-edited Pigs Using Revolutionary Technology 2Proove Biosciences Hosts Symposium on Incorporating Genetic Testing to Optimize the Management of Pain 2Biotech CEO Summit to Bring Key Biotech Leaders Together in Industry Brain Trust 2
... Fibrocell Science, Inc. (OTC Bulletin Board: FCSC) announced today ... U.S. Food and Drug Administration (FDA) related to the Biologics ... the treatment of moderate to severe nasolabial fold wrinkles in ... Center for Biologics Evaluation and Research (CBER) when the review ...
... , ANNAPOLIS, Md., Dec. 21 PharmAthene, Inc. (NYSE Amex: ... biological and chemical threats, today announced the appointment of Jeffrey ... Board to eight members. , Dr. Runge is a ... in business risk management, homeland security and homeland defense. ...
... , BOTHELL, WA and VANCOUVER, ... OGXI ) announced today that the Company will host a ... 21, 2009. , A live webcast will be available through ... http://ir.oncogenex.com . Alternatively, you may access the live conference ...
Cached Biology Technology:Fibrocell Science, Inc. Receives FDA Complete Response Letter Regarding azficel-T for Wrinkles 2PharmAthene Appoints Jeffrey W. Runge, M.D. to the Company's Board of Directors 2PharmAthene Appoints Jeffrey W. Runge, M.D. to the Company's Board of Directors 3OncoGenex Pharmaceuticals to Host Investor Conference Call at 8:30 a.m. ET, December 21, 2009 2
(Date:3/23/2015)... , Mar. 23, 2015 NXT-ID, Inc. (NASDAQ: NXTD ... on the growing mobile commerce market, announces its biometric payment ... campaign on CNBC television starting March 30 th . ... airing in New York markets. ... "We are excited about our new ad campaign following the ...
(Date:3/20/2015)... DUBLIN , Mar. 19, 2015 Research and Markets ... the "Hand Geometry - Global Strategic Business Report" ... worldwide markets for Hand Geometry in US$ Thousands. The report ... , Japan , Europe ... America , and Rest of World. Annual ...
(Date:3/20/2015)... Research and Markets ( http://www.researchandmarkets.com/research/vkzvcs/iris_biometrics ) has ... Strategic Business Report" report to their offering. ... US$ Thousands. The report provides separate comprehensive analytics for the ... , Europe , Asia-Pacific ... Latin America . Annual estimates and forecasts ...
Breaking Biology News(10 mins):NXT-ID's Wocket Smart Wallet to Launch New CNBC Regional TV Ad Campaign 2NXT-ID's Wocket Smart Wallet to Launch New CNBC Regional TV Ad Campaign 3Hand Geometry - Global Strategic Business Report 2015: An Essential Security Component for both Government & Enterprise Sector 2Hand Geometry - Global Strategic Business Report 2015: An Essential Security Component for both Government & Enterprise Sector 3Hand Geometry - Global Strategic Business Report 2015: An Essential Security Component for both Government & Enterprise Sector 4Iris Biometrics - Global Strategic Business Report 2015: System & Network Access Control - A Robust Market Opportunity in the Offing 2Iris Biometrics - Global Strategic Business Report 2015: System & Network Access Control - A Robust Market Opportunity in the Offing 3Iris Biometrics - Global Strategic Business Report 2015: System & Network Access Control - A Robust Market Opportunity in the Offing 4Iris Biometrics - Global Strategic Business Report 2015: System & Network Access Control - A Robust Market Opportunity in the Offing 5
... risk during cardiac procedures. Doctors performing heart surgery also ... IAEA is helping to raise awareness of threats, through ... X-ray imaging systems. The issue of radiation protection ... of lengthy angioplasty and other cardiac interventions performed under ...
... mainly because they lose control of their growth. To better ... University,s Comprehensive Cancer Center looks at four genes that help ... in adults. , The genes E2f1, E2f2, and E2f3a ... help control cell proliferation, a belief that comes from experiments ...
... the atomic bomb blasts in Hiroshima and Nagasaki, Japan, ... later developed papillary thyroid cancer as adults, according to ... of Cancer Research , a journal of the ... subjects who lived close to the blast sites, were ...
Cached Biology News:Protecting those who heal 2Location, location, location important for genes, too 2Researchers discover atomic bomb effect results in adult-onset thyroid cancer 2
... Mouse monoclonal antibody raised against a partial recombinant ... 56 a.a. ~ 145 a.a) partial recombinant protein ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... Buffer I can be used in intracellular ... permeabilize cells and to serve as an ... saponin-mediated cell permeabilization is a reversible process, ... in the presence of saponin during intracellular ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Biology Products: