Navigation Links
Wound Management Technologies to Present at AdvaMed 2011; Conference's Featured Speakers to Include President George W. Bush & HHS Secretary Kathleen Sebelius
Date:9/27/2011

FORT WORTH, Texas, Sept. 27, 2011 /PRNewswire/ -- Wound Management Technologies, Inc., (OTCQB: WNDM | WNDM.PK) a leader in advanced wound care solutions, today announced that its President, Deborah Hutchinson will be presenting at AdvaMed 2011: The MedTech Conference.  The presentation is scheduled for Wednesday, September 28, 2011 at 9:10 in Room 204A of the Walter E. Washington Convention Center in Washington, D.C. Ms. Hutchinson's presentation will cover the 2011 results and offer the attendees insight into the growth opportunities for the Company's products both domestically and internationally.

AdvaMed 2011 brings the biggest names together to discuss the hottest topic in the MedTech industry. This year's conference plenary speakers include:

  • President George W. Bush, 43rd President of the United States
  • Secretary Kathleen Sebelius, Department of Health and Human Services
  • Counselor John M. Taylor, III, Esq. Counselor to the Commissioner, FDA
  • Governor Mitchell E. Daniels, State of Indiana
  • Dr. Jeffrey E. Shuren, Director of Center for Devices and Radiological Health, FDA
  • Governor Martin O'Malley, State of Maryland

Wound Management Technologies has developed a strong schedule for the three-day conference.  Scheduled meetings have been arranged with several dozen potential marketing firms, investment groups, distribution partners, and commercialization groups specializing in both national and international markets. The goal of these meetings is to develop strategic partnerships to increase the knowledge and sales of CellerateRX and to assist in research and development of new product initiatives.

"We are honored to present the Wound Management story at an event that features such notable dignitaries as President Bush, Secretary Sebelius and Governors Daniels and O'Malley, among others.  AdvaM
'/>"/>

SOURCE Wound Management Technologies, Inc.
Copyright©2010 PR Newswire.
All rights reserved

Page: 1 2 3 4

Related biology technology :

1. Bluestar Silicones Presents Adhesive Gels for Wound Care at Medical Grade Polymers Conference
2. Arobella Medical CEO is Issued U.S. Patent for Ultrasound Wound Therapy Technology
3. Glycotex Reports First Patient Enrollment in Phase IIb Study of Lead Product Candidate GLYC-101 for Wound Healing
4. Derma Sciences Announces Multiple Clinical Posters Featuring MEDIHONEY(R) and ALGICELL Ag(R) to be Presented at Upcoming Wound Care Conference
5. Advanced Viral Announces Phase IIb Wound Healing Trial for AVR123
6. Wound Management Technologies, Inc. Announces a Published Case Study
7. Environmental Tectonics Corporation Announces Placement of Two Monoplace Chambers at St. John Wound Center; First Computer-controlled Hyperbaric Chambers in Oklahoma
8. WaferGen Biosystems, ImmuneRegen BioSciences and University of Texas Southwestern Medical Center to Collaborate on Novel Wound Healing Research
9. Stemedica Signs Scientific Advisory Board Agreement with Leading Pediatric Burn & Wound Care Researcher
10. Environmental Tectonics Corporation Exhibiting at the Annual Symposium on Advanced Wound Care and Wound Healing Society
11. ULURU to Present Clinical Evidence and Advanced Research on Altrazeal at the Society for Advance Wound Care Conference for 2009
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:12/19/2014)... The empty capsules market is experiencing ... and technological innovations in the empty capsules market. ... the growth of the empty capsules market. , ... Scope of Report , The report will enrich ... firms to gauge the pulse of the market ...
(Date:12/19/2014)... -- Relmada Therapeutics, Inc. (OTCQB: RLMD), a clinical-stage company ... announced the results of its annual general meeting of ... year in Relmada,s history and it set the stage ... Sergio Traversa , chief executive officer of Relmada. "Over ... human resource and clinical development objectives that position Relmada ...
(Date:12/17/2014)... BASKING RIDGE, N.J. (PRWEB) December 17, 2014 ... Ipsen (Euronext: IPN; ADR: IPSEY), ... 120 mg (referred to as Somatuline®) was approved ... for the treatment of gastroenteropancreatic neuroendocrine tumors (GEP-NETs) ... differentiated, locally advanced or metastatic disease to improve ...
(Date:12/17/2014)... Audacity, a leading California-based health and ... the Huntsworth Health Group, is proud to announce the ... her role, Gonzales will serve as Senior Vice President ... to welcome a talent of Jamie’s caliber to the ... “She is a proven healthcare innovation leader and brand ...
Breaking Biology Technology:Empty Capsules Market Hit to Reach $1,820 Million by 2019 - New Research Report by MarketsandMarkets 2Empty Capsules Market Hit to Reach $1,820 Million by 2019 - New Research Report by MarketsandMarkets 3Empty Capsules Market Hit to Reach $1,820 Million by 2019 - New Research Report by MarketsandMarkets 4Relmada Therapeutics Announces Results of Annual Shareholders Meeting 2Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 2Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 3Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 4Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 5Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 6Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 7Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 8Audacity Welcomes Healthcare Communications Expert Jamie Gonzales as Senior Vice President of Client Services 2
... BioMed Realty Trust, Inc. (NYSE: BMR ), a real ... Science Industry®, today announced financial results for the third quarter ended ... Generated record total revenues for the third quarter of ... in 2009. Increased rental revenues for the third quarter by ...
... to develop relatively advanced tools after their brains evolved a ... that investigates why it took early humans almost two million ... axe. Researchers used computer modelling and tiny sensors embedded ... humans needed in order to make two types of tools ...
... New Mexico, NOVEMBER 3, 2010Scientists at the U.S. Department ... Laboratory have fabricated transparent thin films capable of absorbing ... area. The material, described in the journal Chemistry ... transparent solar panels. "Potentially, with future refinement of ...
Cached Biology Technology:BioMed Realty Trust Reports Third Quarter 2010 Financial Results 2BioMed Realty Trust Reports Third Quarter 2010 Financial Results 3BioMed Realty Trust Reports Third Quarter 2010 Financial Results 4BioMed Realty Trust Reports Third Quarter 2010 Financial Results 5BioMed Realty Trust Reports Third Quarter 2010 Financial Results 6BioMed Realty Trust Reports Third Quarter 2010 Financial Results 7BioMed Realty Trust Reports Third Quarter 2010 Financial Results 8BioMed Realty Trust Reports Third Quarter 2010 Financial Results 9BioMed Realty Trust Reports Third Quarter 2010 Financial Results 10BioMed Realty Trust Reports Third Quarter 2010 Financial Results 11BioMed Realty Trust Reports Third Quarter 2010 Financial Results 12BioMed Realty Trust Reports Third Quarter 2010 Financial Results 13BioMed Realty Trust Reports Third Quarter 2010 Financial Results 14BioMed Realty Trust Reports Third Quarter 2010 Financial Results 15BioMed Realty Trust Reports Third Quarter 2010 Financial Results 16BioMed Realty Trust Reports Third Quarter 2010 Financial Results 17Stone Age humans needed more brain power to make big leap in tool design 2Scientists produce transparent, light-harvesting material 2
(Date:12/11/2014)... 2014  Data Sciences International (DSI), the global ... new series of digital telemetry implants to meet ... series, part of the PhysioTel™ Digital platform, was ... physiologic data when incorporating functional endpoints into repeat-dose ... toxicology studies has evolved from short ECG strips ...
(Date:12/10/2014)... DIEGO , Dec. 9, 2014 CIE ... collaboration catalyst that provides the connective tissue that enhances ... enabling them to easily share client-level information; earned a ... to expand to organizations serving seniors aging in community ... Diego" partner on December 11 th 4-6p. ...
(Date:12/5/2014)... , Dec. 4, 2014  Tute Genomics, a leader ... million in Series A1 funding led by UK-based Eurovestech. ... participated in the investment round. "We are ... community adopts next-generation sequencing and seeks new approaches for ... Reid Robison , MD MBA, and CEO of Tute ...
Breaking Biology News(10 mins):New telemetry implants expected to change how large animal toxicology studies are conducted 2Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 2Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 3Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 4Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 2Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 3
... You don,t need to spray weedkiller to remove the ... with either boiling water, steam or flaming will dispatch even ... a new PhD project from the University of Copenhagen. ... is important that each treatment is dosed correctly. Basically, ...
... Johns Hopkins scientists have engineered cells that behave like ... on one or more unique inputs. This feat, published in ... eventually help researchers create computers that use cells as tiny ... in the Department of Cell Biology and member of the ...
... BETHESDA, MD May 30, 2012 The Genetics Society ... six graduate students and seven postdoctoral researchers as recipients of ... Each of these early-career geneticists receives a $1,000 travel award ... in a laboratory course of their choice that will enhance ...
Cached Biology News:Blanch your weeds 2Training cells to perform Boolean functions? It's logical 2Training cells to perform Boolean functions? It's logical 3The Genetics Society of America announces DeLill Nasser Travel Award recipients 2
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
... kit contains sufficient materials for 1,464 array sample elements. ... 4 each , Blocker BSA in PBS (10X): ... , BupH Phosphate Buffered Saline: 8 packs ... SuperSignal West Pico Luminol Enhancer: 2 x 25 ml ...
Biology Products: