Navigation Links
Waterloo Heights, a Neighborhood Smiles Dental Practice is Taking a Bold New Approach to the Cavity Epidemic
Date:4/19/2013

stions regarding their current habits (eating and drinking, medication use, chronic health issues etc.) as well as undergo a quick, painless swab of their lower teeth (to determine if they have an excess of cavity causing bacteria). Then based on the information gathered, their dental team will counsel them on an appropriate course of action to lower their risk. If professional products are recommended the practitioner will provide the patient with a professional kit of product specifically designed to counteract their risk factors.

Science has proven that this disease cannot be stopped by the drill and fill approach. True cure requires a medical approach and a comprehensive assessment of each patient. Dr. Welch has taken a bold and caring step for his patients and community.

For more information on the CariFree system go to http://www.carifree.com. Call now and make your screening appointment at: (608)519-4382

About Dr. Welch:
Dr. Chris Welch grew up in Colorado and received his undergraduate degree from the University of Denver before going on to earn his Doctorate of Dental Surgery from Northwestern University. While at Northwestern University, Dr. Welch was on the Dean’s List and earned Honors in Oral Pathology.

Dr. Welch has also attended the prestigious Las Vegas Institute for Advanced Dental Studies, which has long been recognized as the pioneer in live-patient, post-graduate dental training. LVI’s curriculum includes restorative dentistry, implants, orthodontics, and root canals.

Dr. Welch’s favorite thing to do outside of work is spend time with his two sons, Sam and Chris, and their Labrador Retriever. He also enjoys fishing, hunting, cooking, golf and traveling.

Read the full story at http://www.prweb.com/releases/2013/4/prweb10644969.htm.


'/>"/>
Source: PRWeb
Copyright©2012 Vocus, Inc.
All rights reserved

Page: 1 2

Related biology technology :

1. Neighborhood Smiles of La Crosse Takes a Bold New Approach to the Tooth Decay Epidemic
2. Neighborhood Smiles of Green Bay Offers a New Approach to the Cavity Epidemic
3. Neighborhood Smiles Launches a Groundbreaking Cavity Prevention Program for Their Patients
4. BIOWATER Wastewater Treatment Package Plant Arrives in Residential Neighborhoods
5. Electronic Headband That Detects and Treats Addictive In-Sleep Behavior to be Demonstrated at Annual Holistic Dental Conference by Holistic Technologies
6. Local Dentist is Saving Lives with His Cutting-Edge Approach to Dental Caries
7. Drogueria Americana, a Honduran Affiliate of GeneCell International, Presents to a Panel of More Than 100 Leading Dentist on Dental Pulp Stem Cells
8. Local Dentist is Saving Lives with her Cutting Edge Approach to Dental Caries
9. Transformation Dental Partners Launch Ground Breaking Cavity Prevention Program that Can Lower Tooth Decay Rates by 74%
10. Deborah Morosini, MD Pathologist and Patient Advocate Signs on as Medical Director and Advisory Board Member of Store-A-Tooth™ Dental Stem Cell Banking
11. LA Dental Bone Graft Substitute & Other Biomaterials Market Reviewed in New iData Research Report Available at MarketPublishers.com
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:11/22/2014)... 21, 2014   ... Commercial Officer zu KLOX    ... Chief Financial Officer bestellt    KLOX ... seines jüngst zugelassenen Behandlungssystems zur Wundheilung zu beginnen    ... "Unternehmen") ist sehr erfreut, die folgenden personellen Veränderungen anzukündigen: ...
(Date:11/21/2014)... BELLINGHAM, Washington, USA (PRWEB) November 19, 2014 ... used in our lives was shared with more than ... undergraduate and postgraduate students from the University of Otago ... Outreach Grant . The Otago students, members of the ... Southland New Zealand in early September, giving children from ...
(Date:11/21/2014)... 20, 2014 The California ... research organization representing leading California academic institutions, biotechnology, ... PwC US today released a report revealing ... industry growth. The trend shows a 4 percent ... California Biomedical Industry Report indicates that, while ...
(Date:11/21/2014)... Fayetteville, Arkansas (PRWEB) November 20, 2014 ... partners, Pinnacle Ozone Solutions, LLC (Pinnacle), and PCI, ... equipment, announced that they have been selected to ... City of Fayetteville, Arkansas Paul R. Noland Wastewater ... feature BlueInGreen’s patented HyDOZ® gas dissolution ...
Breaking Biology Technology:KLOX Technologies meldet Neubesetzung von Führungspositionen 2KLOX Technologies meldet Neubesetzung von Führungspositionen 3KLOX Technologies meldet Neubesetzung von Führungspositionen 4KLOX Technologies meldet Neubesetzung von Führungspositionen 5Optics and photonics outreach programs share science, spark fascination with light 2Optics and photonics outreach programs share science, spark fascination with light 3California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 2California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 3California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 4City of Fayetteville Leads Nation with Innovative Ozone Technology 2City of Fayetteville Leads Nation with Innovative Ozone Technology 3City of Fayetteville Leads Nation with Innovative Ozone Technology 4
... veteran, was promoted to president of the General Electric Medical ... who left to become CEO at Invitrogen. The division focuses ... systems . , ,It's a dream job for a corporate ... about $9 billion and produced GE CEO and Chairman Jeffery ...
... develops and sells employee scheduling and management products. The ... and co-founder of Suite Scheduler, a former nurse manager ... employees in a facility. , ,Suite Scheduler products are ... up to 90% of the time to create and ...
... That is, until he gets to the better drugs, faster ... the science behind the Madison-based companys products is likely to ... nears the age when diseases and treatments become as common ... the two and a half-year-old company that Vodenlich joined as ...
Cached Biology Technology:CEO Wilson Defines GE's Health-IT Customer 2CEO Wilson Defines GE's Health-IT Customer 3CEO Wilson Defines GE's Health-IT Customer 4Scheduling made easy with Suite Scheduler 2Scheduling made easy with Suite Scheduler 3Chipping Away at Drug Development 2Chipping Away at Drug Development 3
(Date:11/18/2014)... , Nov. 18, 2014   EyeLock Inc. ... solutions, and MorphoTrust USA (Safran), a ... today announced a strategic partnership to offer comprehensive ... vehicle administration (MVA), airport screening and financial services ... solutions, MorphoTrust serves consumers through a nationwide network ...
(Date:11/11/2014)... , Nov. 11, 2014  Forensicon, Inc., a ... firm, is pleased to announce the promotion of ... Director of Digital Forensics. In Schiff,s new role as ... the team of digital forensics examiners and provide leadership ... Photo - http://photos.prnewswire.com/prnh/20141110/157719 ...
(Date:11/7/2014)... Calif. , Nov. 7, 2014  In conjunction with ... Police Departments, The Community Foundation of the Verdugos ... DNA JUSTICE PROJECT," a $250,000 initiative to keep ... initial phase. In its first six months of existence, the ... needed evidence support for local law enforcement. "Because ...
Breaking Biology News(10 mins):EyeLock, MorphoTrust Form Strategic Partnership to Pursue Commercial Enterprise Deployments 2EyeLock, MorphoTrust Form Strategic Partnership to Pursue Commercial Enterprise Deployments 3Yaniv Schiff Promoted to Director of Digital Forensics at Forensicon, Inc. 2Community Foundation Of The Verdugos Unveils Campaign To Fund Glendale-Burbank DNA Justice Project 2
... February 26, 2013, New York, N.Y. and San Diego, Calif. ... tumor in adults, is challenging to treat because the tumors ... more about the causes of tumor cell growth and drug ... new targeted therapies to potentially treat this deadly cancer. ...
... 2013, Reston, VAResearchers will meet at the Society of ... a number of health concerns that have received growing ... of the presentations, scientists will explore how the development ... related exposures might affect the risk assessment of arsenic ...
... Rockville, Md. The Association for Research in Vision ... three keynote speakers, including two Nobel laureates, during the ... Wash. New this year, the ARVO/Alcon Keynote Series ... Christopher Murray, MD, DPhil. Smithies, of the University ...
Cached Biology News:Novel combination therapy shuts down escape route, killing glioblastoma tumor cells 2Scientists explore topical health issues at meeting in Texas 23 distinguished keynote speakers to present during ARVO 2013 Annual Meeting 2
... a partial recombinant FES. ... 250 a.a) partial recombinant protein with GST ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: BC035357 ... AAH35357 OMIM: 190030, ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
... sufficient materials for 1,464 array sample elements. , , ... , Blocker BSA in PBS (10X): 50 ml ... BupH Phosphate Buffered Saline: 8 packs , 10% ... Pico Luminol Enhancer: 2 x 25 ml , SuperSignal ...
Biology Products: