Navigation Links
Washington State University to Present on Tin Nanoneedles: A Technology for Lithium-ion Batteries, at Knowledge Foundation’s Next Generation Batteries 2013 Conference
Date:3/13/2013

o Abusleme, Solvay S.A., Belgium
-Kevin L. Gering, PhD, Idaho National Laboratory
-Steven Kaye, PhD, Wildcat Discovery Technologies
-M. Grant Norton, PhD, Washington State University
-Brigitta Pascucci, German Aerospace Center (DLR), Germany*
-Brian Morin, PhD, Dreamweaver International
-David Avison, Madico
-K.M. Abraham, PhD, Northeastern University
-Florence Fusalba, PhD, Laboratory for Innovation in New Energy Technologies and Nanomaterials (LITEN), French Atomic Energy Commission (CEA), France
-Jean-Francois Drillet, DECHEMA Research Institute, Germany
-Elena Shembel, PhD, Enerize Corporation
-Mouli Ramani, Lilliputian Systems, Inc.
-Vincenzo Antonucci, PhD CNR-Istituto di Tecnologie Avanzate per l’Energia, (ITAE), Italy*
-Dmitri L. Danilov, PhD, Eindhoven University of Technology, The Netherlands
-Neil Chertoff, 27th Century Technologies, Inc.
-Chritian Michot, INERIS, France*
-Grietus Mulder, VITO Unit Energy Technology, Belgium*
-Erik J. Spek, PEng, MASc, TÜV SÜD Canada
-Brent Harris, PEng, Sustainable Energy Technologies Ltd., Canada

About The Knowledge Foundation
The Knowledge Foundation integrates scientific ingenuity and real-world applications by fostering collaborative research at the rapidly changing intersection of science and business. Known for providing members of its Technology Commercialization Alliance with direct and unbiased state-of-the-art scientific information, the Knowledge Foundation is uniquely qualified to provide wider exposure for important developments in the emerging fields of alternative energy, nanotechnology, and chemical & biological detection technologies.

Contact:
The Knowledge Foundation
2193 Commonwealth Ave, Suite 398
Boston, MA 02135-3853
Phone: (617) 232-7400
Fax: (617) 232-9171
Email: custserv(at)knowledgefoundation(
'/>"/>

Source: PRWeb
Copyright©2012 Vocus, Inc.
All rights reserved

Page: 1 2 3 4

Related biology technology :

1. CMC Biologics Honored as Finalist for Washingtons Manufacturing Company of the Year Award
2. National Defense Industrial Association (NDIA) Opens Registration For 2012 Biosurveillance Conference, Set For August 27-28 in Washington, D.C.
3. Biodetection 2012 Conference Brings Together Leading Organizations from Around the World to Address Challenges & Technology Advances in Detection and Identification of Biological Threats in Washington, DC from June 28-29, 2012
4. EcoSolutions Prevents Flooding in Washington D.C.
5. Bed Bugs Find Their Way to University of Washington and Hastings-on-Hudson Libraries; Bed Bug Control 911 Advises Use of Bed Bug Spray to Effectively Clear the Pests Away
6. New Strain of Bacteria May Clear up Acne Probiotic Action Explains the New Research Findings from Washington University
7. Arizona State University engineers aim to improve performance of technology in extreme environments
8. MarketsandMarkets: Global Prostate Cancer Therapeutics Market worth $6,457 Million by 2020
9. Antelope Valley Hospital Converts to Masimo rainbow SET for State-of-the-Art Noninvasive Patient Monitoring Capabilities
10. CSL Behring Awards LEAD Grant to Patient Organizations to Educate Constituents on State Insurance Exchanges
11. Mexican State of Tamaulipas Starts Training Doctors in Sangui Wound Management
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:9/19/2014)... YORK, September 18, 2014 Scientists at NYU Langone ... dramatically the efficiency of the process for turning adult ... well-known compounds, including vitamin C. Using the new technique ... cells obtained from adult skin cells by more than ... technique is efficient and reliable, and thus should generally ...
(Date:9/19/2014)... Sept. 19, 2014  Nektar Therapeutics (NASDAQ: ... studies characterizing the analgesic profiles of a series ... receptor agonist molecules. The preclinical research candidates were ... platform. The analgesic properties of kappa ... literature. 1,2 Kappa opioid receptors are expressed ...
(Date:9/19/2014)... -- Dublin ... the addition of the  "Micro Market Monitor : ...      (Logo: http://photos.prnewswire.com/prnh/20130307/600769) , , ,The ... segments in the chromatography market. The market was ... to reach $2.0 billion by 2019, at a ...
(Date:9/18/2014)... -- About POCT POCT, also ... laboratory. It helps in making fast clinical decisions, ... POCT is gaining popularity due to the increasing ... diabetes, heart disease, and obesity. It is generally ... minimize errors during the diagnosis of patients. POCT ...
Breaking Biology Technology:NYU Langone scientists report reliable and highly efficient method for making stem cells 2NYU Langone scientists report reliable and highly efficient method for making stem cells 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 2Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 4Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 5Micro Market Monitor : Global Pre-packed Chromatography Columns 2POCT Market in China 2014-2018 2
... , ... computational drug discovery solutions provider, announced today they have licensed ... Drug Administration,s National Center for Toxicological Research (NCTR). , Under ... access to the complete TIP structural knowledgebase via ...
... , NEW ORLEANS, Dec. 8 HemaQuest Pharmaceuticals presented data ... of its lead drug candidate, HQK-1001, in sickle cell disease ... Society of Hematology in New Orleans. The preclinical studies ... of therapeutic agents that have been used in the past ...
... ... Extended Wear Hearing Aid. , ... Newark, CA (PRWEB) December 8, 2009 -- Whether it’s a crackling fire, jingling sleigh bells, ... miss out on the joyous sounds of the holidays. Lyric, the first 100% invisible ...
Cached Biology Technology:Eidogen-Sertanty Licenses TIP to the FDA 2HemaQuest Pharmaceuticals Presents Promising Results in Sickle Cell Disease and Beta Thalassemia 2HemaQuest Pharmaceuticals Presents Promising Results in Sickle Cell Disease and Beta Thalassemia 3Lyric Presents the Sounds of the Season 2
(Date:9/18/2014)... and their colleagues have built the first smartphone ... performance and behavioral trends. In other words, your ... if you don,t -- and how that affects ... happiness, stress, depression and loneliness to their academic ... population for example, to monitor mental health, ...
(Date:9/18/2014)... celebrated tonight at the third annual Golden Goose Award ... premature infants and in paving the way for the ... supported by the National Science Foundation, the National Institutes ... be honored at a ceremony at the Library of ... of Congress will be on hand to help present ...
(Date:9/18/2014)... when people are too stressed they are often grouchy, ... Mind Institute (BMI) at EPFL have just highlighted a ... stress and the loss of social skills and cognitive ... synaptic regulatory molecule in the brain. This was revealed ... , Carmen Sandi,s team went to look for ...
Breaking Biology News(10 mins):New Dartmouth smartphone app reveals users' mental health, performance, behavior 2New Dartmouth smartphone app reveals users' mental health, performance, behavior 3New Dartmouth smartphone app reveals users' mental health, performance, behavior 43rd annual Golden Goose award ceremony honors 8 researchers; Unusual work had big results 2How stress tears us apart 2
... DNA is copied into ribonucleic acid (RNA) molecules, also ... making proteins, and a collection of all the transcripts ... Jaiswal, Assistant Professor of Botany and Plant Pathology at ... Jaiswal,s laboratory, and colleagues assembled transcriptomes of a noxious ...
... AMHERST, Mass. Biochemists at the University of Massachusetts ... insight into how protein synthesis and degradation help to ... they reveal how two proteins shelter each other in ... and safely. Cells must routinely dispose of leftover ...
... University of Florida paleontologists have discovered remarkably well-preserved fossils ... science during recent Panama Canal excavations that began in ... and an extinct hippo-like species inhabited Central America during ... expands the range of ancient animals in the subtropics ...
Cached Biology News:Assembling the transcriptome of a noxious weed: New resources for studying how plants invade 2New insight into double-protected dance of cell division 2UF scientists discover new crocodilian, hippo-like species from Panama 2UF scientists discover new crocodilian, hippo-like species from Panama 3
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
...
... polyclonal antibody raised against a partial recombinant ... (AAH35357, 120 a.a. ~ 250 a.a) partial ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Biology Products: