Navigation Links
WaferGen Bio-systems and QIAGEN KK Sign Agreement for Co-Marketing in Japan
Date:2/19/2013

FREMONT, Calif., Feb. 19, 2013 /PRNewswire/ -- WaferGen Bio-systems, Inc. (OTCBB: WGBS) announced today a co-marketing agreement with QIAGEN KK – a subsidiary of QIAGEN N.V.– for the joint promotion of certain products in Japan in the areas of genomics platforms such as Next-Gen sequencing (NGS) and qPCR.  With the joint offering, customers will be able to seamlessly plan and execute complex research projects involving molecular biomarker discovery with NGS, where WaferGen's SmartChip will offer a powerful platform for high-throughput qPCR-based target validation.  The purpose of the commercial relationship is to help life science researchers accelerate the process of developing markers that are potential candidates for molecular diagnostics by adding WaferGen's SmartChip solution to facilitate biomarker validation.  Further customer-facing synergies will be achieved by offering QIAGEN's PCRarrays on the SmartChip and subsequently compatible NGS panels from QIAGEN.

Stephane Perrey , President of QIAGEN KK stated: "We are looking forward to expanding our portfolio of life science offerings in Japan through the co-marketing of WaferGen's high-throughput qPCR solution.  There is a substantial customer need to ramp up discovery efforts through targeted screening and confirmation, and our integrated approach will provide one-stop shopping for a variety of academic and industrial clients.  We will be able to guide customers through the series of steps necessary for an effective biomarker discovery and validation program, by providing both the instrumentation and assays necessary for the accomplishment of their scientific goals.  We have successfully evaluated WaferGen's SmartChip System, and we believe that it can play an important role in our comprehensive product offering."

"We are extremely pleased t
'/>"/>

SOURCE WaferGen Biosystems, Inc.
Copyright©2012 PR Newswire.
All rights reserved

0

GOOD

Page: 1 2 3 4

Related biology technology :

1. WaferGen Reports Third Quarter 2011 Financial Results and Announces New Commercialization Strategy
2. WaferGen to Present Corporate Overview at Oppenheimer Healthcare Conference
3. WaferGen to Present Corporate Overview at 5th Annual OneMedForum San Francisco 2012
4. WaferGen Bio-systems Announces Open Format qPCR Platform and Strategic Realignment
5. WaferGen Bio-systems Awarded 1 Million Euro Grant by the Luxembourg Government to expand its European Operations
6. WaferGens MyDesign Open Platform Facilitates Rapid Development of a Proprietary Prostate Cancer Diagnostic Panel in the Lab of Dr. Arul Chinnaiyan at the University of Michigan Cancer Center
7. QIAGEN and Max Planck Institute for Infection Biology Collaborate to Develop Assay for Active TB Risk in Individuals With Latent Infection
8. QIAGEN Gains Rights to Genomic Biomarkers for Lung, Brain and Other Cancers to Expand its Pipeline of Companion Diagnostics
9. BioHealth Innovation, Inc. Appoints Qiagens Douglas Liu to Board of Directors
10. QIAGEN Joins Grand Challenges in Global Health Initiative to Bring Advanced Point-of-Care Diagnostics to Worlds Poorest Countries
11. QIAGEN Acquires AmniSure International to Add Unique Assay to Emerging Point of Need Portfolio
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:6/19/2013)... Today DuPont Executive Vice President James C. Borel ... greatest challenge facing our time – ensuring food security ... at the International Food and Agribusiness Management Association ... students to contribute their time and talents to create ... collaboration with others. , “Food is one of the ...
(Date:6/19/2013)... India’s vast and growing population ... worth up to a billion dollars per year ... is taking serious action to better regulate and ... presentation will examine:, ,     Recent changes ... and long term impacts ,     Foreseeable opportunities ...
(Date:6/19/2013)... Adding to their already extensive supply ... Simport’s Dropette® and Heathrow Scientific disposable plastic ... basic biology, chemistry and any type of liquid handling ... 35 years, Simport has been supplying the science community ... the Simport Dropette®. Simport’s Dropette® is a one-piece ...
(Date:6/18/2013)... New York, NY (PRWEB) June 18, 2013 ... technological innovation and sustainability, the Consulate General of Switzerland ... largest solar boat, Switzerland’s MS Tûranor PlanetSolar , ... as part of its DeepWater Expedition 2013 tour with ... catamaran, led by Capitain Gérard d’Aboville, runs exclusively on ...
Breaking Biology Technology:DuPont Leader Calls for New Generation of Food Visionaries to Fight Hunger 2Leading Pipette Distributor Pipette.com Now Stocks Transfer Pipettes: Simport’s Dropette and Heathrow Scientific Disposable Plastic Transfer Pipettes 2Switzerland’s MS Tûranor PlanetSolar, the World’s Largest Solar Boat, Arrives in New York City 2Switzerland’s MS Tûranor PlanetSolar, the World’s Largest Solar Boat, Arrives in New York City 3Switzerland’s MS Tûranor PlanetSolar, the World’s Largest Solar Boat, Arrives in New York City 4
... MOUNTAIN VIEW, Calif., Jan. 17, 2012  MAP Pharmaceuticals, Inc. (Nasdaq: ... James O,Shea to its Board of Directors. Mr. O,Shea brings ... product commercialization and operations. "We are privileged to ... time in the Company,s development as we focus our efforts ...
... 16, 2012 Luminex Corporation (Nasdaq: LMNX ) ... fourth quarter and full year 2011 on Monday, February 6, ... release after the close of trading. (Logo: ... conference call to discuss the operating highlights and financial results ...
... 2012 Elsevier, a world-leading provider ... services, announced today that its first bilingual platform of ... , is now available online. NursingChina ... available in China, featuring skills within specialties such ...
Cached Biology Technology:MAP Pharmaceuticals Appoints W. James O'Shea to Board of Directors 2MAP Pharmaceuticals Appoints W. James O'Shea to Board of Directors 3Luminex Corporation Fourth Quarter and Full Year 2011 Earnings Release Scheduled for February 6, 2012 2Luminex Corporation Fourth Quarter and Full Year 2011 Earnings Release Scheduled for February 6, 2012 3Elsevier Launches Bilingual International Nursing Skill Training and Management Platform: NursingChina.com 2Elsevier Launches Bilingual International Nursing Skill Training and Management Platform: NursingChina.com 3
(Date:6/19/2013)... MOUNTAIN VIEW, Calif. , June 20, 2013 ... the personalized cosmeceuticals market, Frost & Sullivan recognizes ... Sullivan Award for New Product Innovation. geneOnyx leverages ... point-of-care testing to create an on-the-spot genetic test ... only a single-step DNA collection procedure from saliva ...
(Date:6/19/2013)... is playing a vital role in the survival of ... to climate and environmental changes, according to new research ... savannah birds from the Tanzanian Bird Atlas project - ... - the researchers found that they are using protected ... further west where dry seasons are getting longer, with ...
(Date:6/19/2013)... 19, 2013   Mercy Medical Center ... technology for conducting on-demand, Hemoglobin A 1c ... well as analysis of important red blood ... The new system enables the hospital to ... physicians and their patients, which can improve ...
Breaking Biology News(10 mins):Frost & Sullivan Applauds geneOnyx for its DNA Testing Solution for the Personalized Cosmeceuticals Market 2Frost & Sullivan Applauds geneOnyx for its DNA Testing Solution for the Personalized Cosmeceuticals Market 3Frost & Sullivan Applauds geneOnyx for its DNA Testing Solution for the Personalized Cosmeceuticals Market 4Protected areas provide African birds with stepping stones to survival 2Mercy Lab Offers Faster On-demand Diabetes Testing, Cellular Studies 2Mercy Lab Offers Faster On-demand Diabetes Testing, Cellular Studies 3Mercy Lab Offers Faster On-demand Diabetes Testing, Cellular Studies 4
... in biomedical science are on the horizon with ... Infrastructure (Instruct) in support of European biomedical research. ... (ESFRI) is involved in establishing about 40 such ... is one such biomedical project, whose aim is ...
... center responsible for responding goes into gear, setting off a ... from the adrenal glands. Dr. Gil Levkowitz ... now revealed a new kind of ON-OFF switch in the ... from the brain that stimulates cortisol release in the body. ...
... by a University of California, Davis, plant scientist delivers a ... world-renowned wine industry. The study is set for publication ... the Proceedings of the National Academy of Sciences. "Many ... plant, but we believe that most microbes would have difficulty ...
Cached Biology News:European Integrated Structural Biology Infrastructure launching 2A unique on-off switch for hormone production 2Fused genes tackle deadly Pierce's disease in grapevines 2
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Mouse monoclonal antibody raised against a full length recombinant GPT. NCBI Entrez Gene ID = GPT...
Rabbit polyclonal antibody to GluR2...
Biology Products: