Navigation Links
VAP(R) Cholesterol Test From Atherotech Covers an Additional 9 Million of Florida Insured
Date:8/12/2008

ive cholesterol test available today, reporting 15 separate components of blood cholesterol as opposed to four in a standard test, and is the only cholesterol test to identify markers for Metabolic Syndrome, a precursor for diabetes. The test has been shown to identify over twice the number of patients with lipid abnormalities than the standard lipid panel (cholesterol and triglyceride test). Risks of both heart disease and diabetes can be reduced with the right preventive treatments, which is why more accurate diagnosis is critical.

The VAP Test is available nationwide. Consumers interested in the test can ask their doctor for more information or visit http://www.thevaptest.com. Individuals should always check their plan for specific benefit coverage.

About Atherotech, Inc.

Atherotech is a cardio-diagnostic company focusing on direct measurement of the comprehensive lipid panel using the company's patented VAP technology, which reports the cholesterol content of all lipids, components and subclasses. The VAP Test is the first cholesterol profile to comply with updated National Cholesterol Education Program ATP III recommendations for LDL measurement and the only commercially available advanced lipid profile that routinely reports all three lipoprotein parameters considered necessary by the American Diabetes Association and American College of Cardiology expert consensus guidelines. The VAP Cholesterol Test is available through national and regional diagnostic laboratories and is reimbursed by many of the largest private insurers as well as Medicare. For more information, visit http://www.thevaptest.com.


'/>"/>
SOURCE Atherotech, Inc.
Copyright©2008 PR Newswire.
All rights reserved

Page: 1 2

Related biology technology :

1. VAP(R) Cholesterol Test Bolsters Biophysical(R) Health Assessment
2. Atherotech VAP Cholesterol Test Meets Updated ADA, ACC Measurement and Treatment Guidelines for High Risk Patients
3. New Data Published in Circulation Showed an Increase in HDL Cholesterol Levels with ACTOS(R) (pioglitazone HCl)
4. Abbott Receives FDA Approval for SIMCOR(R) (Niaspan(R) / simvastatin), a Novel Combination Medicine for Comprehensive Cholesterol Management
5. VAP Cholesterol Test From Atherotech Covers 90 Percent of Arizona Insured
6. Atherotech Says Detailed Cholesterol Test Can Help Doctors and Patients Choose Best Therapy
7. Phosphagenics Reports Superior Pre-clinical Cholesterol Results from APA-01 and Atorvastatin Combination
8. Phase 1 Studies Show Promise of QuatRxs Novel Compound, Sobetirome, for Lowering LDL Cholesterol Levels
9. Reverse Cholesterol Transport by RVX-208 a Small Molecule for ApoA-I Production Increase Presented at American Heart Association Scientific Meeting
10. New Survey Reveals Many Adults With High Cholesterol Fail to Take Necessary Steps to Improve Their Condition
11. Atherotech to Exhibit the VAP Test at Internal Medicine 2008
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:3/25/2015)... March 25, 2015  The Technology Association of ... dedicated to the promotion and economic advancement of ... Health as one of its Top 40 Innovative Technology ... recognize this prestigious group at the 2015 Georgia Technology ... Galleria Centre. TAG,S Top 40 Awards recognize ...
(Date:3/25/2015)... 2015  18 piglets born recently are the ... scientists in the College of Agriculture and Natural Resources at ... in the field of genetic engineering. Bhanu Telugu, ... & Avian Sciences (ANSC) and Ki-Eun Park, PhD, ... genome-edited pigs using a recently developed, groundbreaking technique ...
(Date:3/25/2015)... Proove Biosciences , a commercial ... announce the success of their commercially supported symposium, ... Optimize the Management of Pain, at the 31st Annual ... Maryland on Thursday, March 19th, 2015. , ... Lynn Webster , M.D., former Florida Society of ...
(Date:3/25/2015)... March 25, 2015   Demy-Colton Life Science Advisors ... and business development conferences exclusively for the biopharmaceutical and ... the Biotech CEO Summit. The Biotech ... brings together biotech industry leaders who are united by ... while reaping the rewards of biotech,s new golden age. ...
Breaking Biology Technology:Streamline Health, Inc. Named a TAG Top 40 Innovative Technology Company 2Streamline Health, Inc. Named a TAG Top 40 Innovative Technology Company 3Streamline Health, Inc. Named a TAG Top 40 Innovative Technology Company 4University of Maryland Researchers Successfully Produce Genome-edited Pigs Using Revolutionary Technology 2Proove Biosciences Hosts Symposium on Incorporating Genetic Testing to Optimize the Management of Pain 2Biotech CEO Summit to Bring Key Biotech Leaders Together in Industry Brain Trust 2
... Fibrocell Science, Inc. (OTC Bulletin Board: FCSC) announced today ... U.S. Food and Drug Administration (FDA) related to the Biologics ... the treatment of moderate to severe nasolabial fold wrinkles in ... Center for Biologics Evaluation and Research (CBER) when the review ...
... , ANNAPOLIS, Md., Dec. 21 PharmAthene, Inc. (NYSE Amex: ... biological and chemical threats, today announced the appointment of Jeffrey ... Board to eight members. , Dr. Runge is a ... in business risk management, homeland security and homeland defense. ...
... , BOTHELL, WA and VANCOUVER, ... OGXI ) announced today that the Company will host a ... 21, 2009. , A live webcast will be available through ... http://ir.oncogenex.com . Alternatively, you may access the live conference ...
Cached Biology Technology:Fibrocell Science, Inc. Receives FDA Complete Response Letter Regarding azficel-T for Wrinkles 2PharmAthene Appoints Jeffrey W. Runge, M.D. to the Company's Board of Directors 2PharmAthene Appoints Jeffrey W. Runge, M.D. to the Company's Board of Directors 3OncoGenex Pharmaceuticals to Host Investor Conference Call at 8:30 a.m. ET, December 21, 2009 2
(Date:3/23/2015)... , Mar. 23, 2015 NXT-ID, Inc. (NASDAQ: NXTD ... on the growing mobile commerce market, announces its biometric payment ... campaign on CNBC television starting March 30 th . ... airing in New York markets. ... "We are excited about our new ad campaign following the ...
(Date:3/20/2015)... DUBLIN , Mar. 19, 2015 Research and Markets ... the "Hand Geometry - Global Strategic Business Report" ... worldwide markets for Hand Geometry in US$ Thousands. The report ... , Japan , Europe ... America , and Rest of World. Annual ...
(Date:3/20/2015)... Research and Markets ( http://www.researchandmarkets.com/research/vkzvcs/iris_biometrics ) has ... Strategic Business Report" report to their offering. ... US$ Thousands. The report provides separate comprehensive analytics for the ... , Europe , Asia-Pacific ... Latin America . Annual estimates and forecasts ...
Breaking Biology News(10 mins):NXT-ID's Wocket Smart Wallet to Launch New CNBC Regional TV Ad Campaign 2NXT-ID's Wocket Smart Wallet to Launch New CNBC Regional TV Ad Campaign 3Hand Geometry - Global Strategic Business Report 2015: An Essential Security Component for both Government & Enterprise Sector 2Hand Geometry - Global Strategic Business Report 2015: An Essential Security Component for both Government & Enterprise Sector 3Hand Geometry - Global Strategic Business Report 2015: An Essential Security Component for both Government & Enterprise Sector 4Iris Biometrics - Global Strategic Business Report 2015: System & Network Access Control - A Robust Market Opportunity in the Offing 2Iris Biometrics - Global Strategic Business Report 2015: System & Network Access Control - A Robust Market Opportunity in the Offing 3Iris Biometrics - Global Strategic Business Report 2015: System & Network Access Control - A Robust Market Opportunity in the Offing 4Iris Biometrics - Global Strategic Business Report 2015: System & Network Access Control - A Robust Market Opportunity in the Offing 5
... risk during cardiac procedures. Doctors performing heart surgery also ... IAEA is helping to raise awareness of threats, through ... X-ray imaging systems. The issue of radiation protection ... of lengthy angioplasty and other cardiac interventions performed under ...
... mainly because they lose control of their growth. To better ... University,s Comprehensive Cancer Center looks at four genes that help ... in adults. , The genes E2f1, E2f2, and E2f3a ... help control cell proliferation, a belief that comes from experiments ...
... the atomic bomb blasts in Hiroshima and Nagasaki, Japan, ... later developed papillary thyroid cancer as adults, according to ... of Cancer Research , a journal of the ... subjects who lived close to the blast sites, were ...
Cached Biology News:Protecting those who heal 2Location, location, location important for genes, too 2Researchers discover atomic bomb effect results in adult-onset thyroid cancer 2
... Mouse monoclonal antibody raised against a partial recombinant ... 56 a.a. ~ 145 a.a) partial recombinant protein ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... Buffer I can be used in intracellular ... permeabilize cells and to serve as an ... saponin-mediated cell permeabilization is a reversible process, ... in the presence of saponin during intracellular ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Biology Products: