Navigation Links
UPMC Invests in Intelligent Infrastructure with IBM to Support Vision of Personalized Medicine
Date:9/5/2012

ARMONK, N.Y., Sept. 5, 2012 /PRNewswire/ -- UPMC, one of the nation's leading academic medical centers, today announced the renewal of its agreement with IBM (NYSE: IBM) to continue enhancing computing and storage performance and reliability. UPMC's new technology investment with IBM, valued at $120 million over the next four years, will support the healthcare system's goal of changing the way that treatments are designed for individual patients by effectively using massive volumes of patient and research data.

(Logo:  http://photos.prnewswire.com/prnh/20090416/IBMLOGO )

Under the original agreement with IBM signed in 2005, UPMC saved or avoided costs of more than $191 million over six years, eliminating the need to create a new data center and supporting UPMC's rapid growth. Under the new agreement, IBM and UPMC will continue to collaborate on the development of medical technologies that improve care and the patient experience and remain among the founding partners in the Center for Connected Medicine, a showcase for how technology can transform healthcare.

"UPMC is keenly focused on creating new models of effective and affordable care, supported by good science and smart technology. Extending our long partnership with IBM is a key part of that strategy," said Chief Information Officer Daniel Drawbaugh.

IBM worked with UPMC to design a dynamic, virtualized technology infrastructure that shortened information backup times by 20 percent and recovery times by 50 percent. IBM's expertise in storage and server virtualization allowed the re-engineered network to become more adaptable and flexible to meet expanding patient volume and data growth for UPMC's more than 20 hospitals and 400 outpatient locations. The i
'/>"/>

SOURCE IBM
Copyright©2012 PR Newswire.
All rights reserved

Page: 1 2 3

Related biology technology :

1. JumpStart Invests $250,000 in Milo Biotechnology
2. AFFiRiS AG Invests Into Human Capital - Chief Business Officer Recruited
3. Chicago Celebrates First Informatics Week, Co-Chaired by Intelligent Medical Objects and Northwestern University
4. Leading Pharmaceutical Marketing Research and Consulting Company Introduces Intelligent Efficiency Program
5. Dr. Alice Jacobs, CEO of IntelligentMDx, Named Best Entrepreneur in Eighth Annual Stevie® Awards for Women in Business
6. ARMGO Pharma, Inc. announces data which supports its Rycal program as a novel approach for the treatment of stress-induced cognitive disorders
7. Elekta President and CEO Tomas Puusepp Pledges Support in Addressing Global Cancer Challenge at World Cancer Leaders Summit in Montreal
8. Elusys Awarded Additional $50.2 Million Under An Exisiting U.S. Government Contract To Support Final Stages Of Development Of ETI-204, For Treatment Of Inhalational Anthrax
9. The Law Office of Roger G. Worthington, P.C. - Longtime Supporter of the Pacific Meso Center - Donates $100,000 for Mesothelioma Research
10. Bio-Innovator Saneron CCEL Therapeutics Supports Cryo-Cell International Leadership and Board of Directors in Proxy Contest
11. Pressure BioSciences, Inc. Reaches Agreement with Investors on Initial $600,000 Tranche of $1.2 Million Above-Market Private Placement; Proceeds to Support Continued Commercialization of PCT Product Platform
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:11/22/2014)... 21, 2014   ... Commercial Officer zu KLOX    ... Chief Financial Officer bestellt    KLOX ... seines jüngst zugelassenen Behandlungssystems zur Wundheilung zu beginnen    ... "Unternehmen") ist sehr erfreut, die folgenden personellen Veränderungen anzukündigen: ...
(Date:11/21/2014)... BELLINGHAM, Washington, USA (PRWEB) November 19, 2014 ... used in our lives was shared with more than ... undergraduate and postgraduate students from the University of Otago ... Outreach Grant . The Otago students, members of the ... Southland New Zealand in early September, giving children from ...
(Date:11/21/2014)... 20, 2014 The California ... research organization representing leading California academic institutions, biotechnology, ... PwC US today released a report revealing ... industry growth. The trend shows a 4 percent ... California Biomedical Industry Report indicates that, while ...
(Date:11/21/2014)... Fayetteville, Arkansas (PRWEB) November 20, 2014 ... partners, Pinnacle Ozone Solutions, LLC (Pinnacle), and PCI, ... equipment, announced that they have been selected to ... City of Fayetteville, Arkansas Paul R. Noland Wastewater ... feature BlueInGreen’s patented HyDOZ® gas dissolution ...
Breaking Biology Technology:KLOX Technologies meldet Neubesetzung von Führungspositionen 2KLOX Technologies meldet Neubesetzung von Führungspositionen 3KLOX Technologies meldet Neubesetzung von Führungspositionen 4KLOX Technologies meldet Neubesetzung von Führungspositionen 5Optics and photonics outreach programs share science, spark fascination with light 2Optics and photonics outreach programs share science, spark fascination with light 3California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 2California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 3California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 4City of Fayetteville Leads Nation with Innovative Ozone Technology 2City of Fayetteville Leads Nation with Innovative Ozone Technology 3City of Fayetteville Leads Nation with Innovative Ozone Technology 4
... veteran, was promoted to president of the General Electric Medical ... who left to become CEO at Invitrogen. The division focuses ... systems . , ,It's a dream job for a corporate ... about $9 billion and produced GE CEO and Chairman Jeffery ...
... develops and sells employee scheduling and management products. The ... and co-founder of Suite Scheduler, a former nurse manager ... employees in a facility. , ,Suite Scheduler products are ... up to 90% of the time to create and ...
... That is, until he gets to the better drugs, faster ... the science behind the Madison-based companys products is likely to ... nears the age when diseases and treatments become as common ... the two and a half-year-old company that Vodenlich joined as ...
Cached Biology Technology:CEO Wilson Defines GE's Health-IT Customer 2CEO Wilson Defines GE's Health-IT Customer 3CEO Wilson Defines GE's Health-IT Customer 4Scheduling made easy with Suite Scheduler 2Scheduling made easy with Suite Scheduler 3Chipping Away at Drug Development 2Chipping Away at Drug Development 3
(Date:11/18/2014)... , Nov. 18, 2014   EyeLock Inc. ... solutions, and MorphoTrust USA (Safran), a ... today announced a strategic partnership to offer comprehensive ... vehicle administration (MVA), airport screening and financial services ... solutions, MorphoTrust serves consumers through a nationwide network ...
(Date:11/11/2014)... , Nov. 11, 2014  Forensicon, Inc., a ... firm, is pleased to announce the promotion of ... Director of Digital Forensics. In Schiff,s new role as ... the team of digital forensics examiners and provide leadership ... Photo - http://photos.prnewswire.com/prnh/20141110/157719 ...
(Date:11/7/2014)... Calif. , Nov. 7, 2014  In conjunction with ... Police Departments, The Community Foundation of the Verdugos ... DNA JUSTICE PROJECT," a $250,000 initiative to keep ... initial phase. In its first six months of existence, the ... needed evidence support for local law enforcement. "Because ...
Breaking Biology News(10 mins):EyeLock, MorphoTrust Form Strategic Partnership to Pursue Commercial Enterprise Deployments 2EyeLock, MorphoTrust Form Strategic Partnership to Pursue Commercial Enterprise Deployments 3Yaniv Schiff Promoted to Director of Digital Forensics at Forensicon, Inc. 2Community Foundation Of The Verdugos Unveils Campaign To Fund Glendale-Burbank DNA Justice Project 2
... February 26, 2013, New York, N.Y. and San Diego, Calif. ... tumor in adults, is challenging to treat because the tumors ... more about the causes of tumor cell growth and drug ... new targeted therapies to potentially treat this deadly cancer. ...
... 2013, Reston, VAResearchers will meet at the Society of ... a number of health concerns that have received growing ... of the presentations, scientists will explore how the development ... related exposures might affect the risk assessment of arsenic ...
... Rockville, Md. The Association for Research in Vision ... three keynote speakers, including two Nobel laureates, during the ... Wash. New this year, the ARVO/Alcon Keynote Series ... Christopher Murray, MD, DPhil. Smithies, of the University ...
Cached Biology News:Novel combination therapy shuts down escape route, killing glioblastoma tumor cells 2Scientists explore topical health issues at meeting in Texas 23 distinguished keynote speakers to present during ARVO 2013 Annual Meeting 2
... a partial recombinant FES. ... 250 a.a) partial recombinant protein with GST ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: BC035357 ... AAH35357 OMIM: 190030, ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
... sufficient materials for 1,464 array sample elements. , , ... , Blocker BSA in PBS (10X): 50 ml ... BupH Phosphate Buffered Saline: 8 packs , 10% ... Pico Luminol Enhancer: 2 x 25 ml , SuperSignal ...
Biology Products: