Navigation Links
UC Riverside nanotechnologists help launch new national center devoted to microelectronics
Date:1/18/2013

rovement in electronics."

Kawakami's research group will be working on the fabrication and testing of spintronic devices made from two-dimensional crystals, namely metal dichalcogenides (inorganic materials with unique electronic properties) and graphene. Bartels's and Ozkan's research groups will be working on the growth and characterization of two-dimensional metal dichalchogenides. Bartels, a professor of chemistry, Ozkan, a professor of mechanical engineering, and Kawakami are part of the Materials Science and Engineering Graduate Program at UCR.

C-SPIN's director Jian-Ping Wang, an electrical and computer engineering professor at the University of Minnesota, explained that the ability to scale semiconductor technology has led to the information revolution of the past half-century.

"However, today's semiconductor technology is reaching its fundamental limits in terms of density and power consumption," he said. "Spin-based logic and memory based on the hybridization of magnetic materials and semiconductors have the potential to create computers that are smaller, faster and more energy-efficient than conventional charge-based systems."

Spin-based computing has gained considerable interest recently due to advances in a number of areas. It can combine memory and logic at the device and circuit level, thereby leading to much faster operation for data-intensive applications. This is crucial in the information age and includes applications such as searching, sorting, and image recognition.

Especially important is the room temperature spin transport in graphene with high spin injection efficiency, first demonstrated by Kawakami's group. C-SPIN will help develop the graphene spintronic devices as well as explore new two-dimensional metal dichalcogenides, which are e
'/>"/>

Contact: Iqbal Pittalwala
iqbal@ucr.edu
951-827-6050
University of California - Riverside
Source:Eurekalert  

Page: 1 2 3

Related biology technology :

1. High honor for 2 UC Riverside physicists
2. VaxyGen Assay Services, LLC Announces Launch of Custom Bioassay Services and Operations
3. iBioLaunch™ Technology Successfully Applied to Modified C1 Inhibitor
4. GenWay Biotech Launches New Cardiovascular Diagnostic Blood Test at American Heart Association Scientific Sessions 2011
5. GeneTex Antibody Company to Launch New Line of Primary Antibodies for the Study of Spindle Assembly
6. The Law Firm of Levi & Korsinsky, LLP Launches an Investigation Into Possible Securities Laws Violations by Pacific Biosciences of California, Inc.
7. BioLife Solutions Launches Search Engine Optimized Website and 1,000 Free Samples Offer
8. Experts Launch the Alliance for Fertility Preservation at the International Society for Fertility Preservations 2nd World Congress
9. Cellular Dynamics Announces Commercial Launch of iCell® Neurons for Neuroscience Drug Discovery
10. Elsevier and Federation of Biochemical Societies Launch New Journal: FEBS Open Bio
11. ReproCELL Licensed Commercialization Right on Human iPS Cell Derived Hepatocytes - Expected Launch in Q2 2012
Post Your Comments:
*Name:
*Comment:
*Email:
Related Image:
UC Riverside nanotechnologists help launch new national center devoted to microelectronics
(Date:12/19/2014)... BioPlus Specialty Pharmacy ... has an expanded team of Regional Pharmaceutical Care ... prescriber offices in their regions, with specific areas ... a variety of Regional Pharmaceutical Care Liaisons specializing ... hepatitis C help prescribers understand all the new ...
(Date:12/19/2014)... ME (PRWEB) December 18, 2014 Ed ... director of the Center for Excellence in the Neurosciences ... New England, has been selected as a member of ... is the first neuroscientist from Maine to receive this ... nonprofit organization supported entirely by the Dana Foundation. ...
(Date:12/19/2014)... 2014 In contrast to traditional LED ... various colors, Valoya uses proprietary LED technology to incorporate ... possible uniformity which is critical in low proximity installations. ... accuracy throughout its lifetime which is up to four ... , "The investment cost was clearly higher when compared ...
(Date:12/19/2014)... Mass. , Dec. 18, 2014  Decision Resources ... dental biomaterial market will grow moderately through 2023 ... procedures and growing awareness of dental biomaterials all spur ... markets such as China and ... will bring dental procedures within reach for a larger ...
Breaking Biology Technology:BioPlus Specialty Pharmacy Expands ‘Regional Pharmaceutical Care Liaison’ Team 2BioPlus Specialty Pharmacy Expands ‘Regional Pharmaceutical Care Liaison’ Team 3UNE's Ed Bilsky Named Member of Dana Alliance for Brain Initiatives 2UNE's Ed Bilsky Named Member of Dana Alliance for Brain Initiatives 3Asia Pacific Dental Biomaterial Market Will Grow Strongly Through 2023 2Asia Pacific Dental Biomaterial Market Will Grow Strongly Through 2023 3
... BioMed Realty Trust, Inc. (NYSE: BMR ), a real ... Science Industry®, today announced financial results for the third quarter ended ... Generated record total revenues for the third quarter of ... in 2009. Increased rental revenues for the third quarter by ...
... to develop relatively advanced tools after their brains evolved a ... that investigates why it took early humans almost two million ... axe. Researchers used computer modelling and tiny sensors embedded ... humans needed in order to make two types of tools ...
... New Mexico, NOVEMBER 3, 2010Scientists at the U.S. Department ... Laboratory have fabricated transparent thin films capable of absorbing ... area. The material, described in the journal Chemistry ... transparent solar panels. "Potentially, with future refinement of ...
Cached Biology Technology:BioMed Realty Trust Reports Third Quarter 2010 Financial Results 2BioMed Realty Trust Reports Third Quarter 2010 Financial Results 3BioMed Realty Trust Reports Third Quarter 2010 Financial Results 4BioMed Realty Trust Reports Third Quarter 2010 Financial Results 5BioMed Realty Trust Reports Third Quarter 2010 Financial Results 6BioMed Realty Trust Reports Third Quarter 2010 Financial Results 7BioMed Realty Trust Reports Third Quarter 2010 Financial Results 8BioMed Realty Trust Reports Third Quarter 2010 Financial Results 9BioMed Realty Trust Reports Third Quarter 2010 Financial Results 10BioMed Realty Trust Reports Third Quarter 2010 Financial Results 11BioMed Realty Trust Reports Third Quarter 2010 Financial Results 12BioMed Realty Trust Reports Third Quarter 2010 Financial Results 13BioMed Realty Trust Reports Third Quarter 2010 Financial Results 14BioMed Realty Trust Reports Third Quarter 2010 Financial Results 15BioMed Realty Trust Reports Third Quarter 2010 Financial Results 16BioMed Realty Trust Reports Third Quarter 2010 Financial Results 17Stone Age humans needed more brain power to make big leap in tool design 2Scientists produce transparent, light-harvesting material 2
(Date:12/11/2014)... 2014  Data Sciences International (DSI), the global ... new series of digital telemetry implants to meet ... series, part of the PhysioTel™ Digital platform, was ... physiologic data when incorporating functional endpoints into repeat-dose ... toxicology studies has evolved from short ECG strips ...
(Date:12/10/2014)... DIEGO , Dec. 9, 2014 CIE ... collaboration catalyst that provides the connective tissue that enhances ... enabling them to easily share client-level information; earned a ... to expand to organizations serving seniors aging in community ... Diego" partner on December 11 th 4-6p. ...
(Date:12/5/2014)... , Dec. 4, 2014  Tute Genomics, a leader ... million in Series A1 funding led by UK-based Eurovestech. ... participated in the investment round. "We are ... community adopts next-generation sequencing and seeks new approaches for ... Reid Robison , MD MBA, and CEO of Tute ...
Breaking Biology News(10 mins):New telemetry implants expected to change how large animal toxicology studies are conducted 2Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 2Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 3Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 4Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 2Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 3
... You don,t need to spray weedkiller to remove the ... with either boiling water, steam or flaming will dispatch even ... a new PhD project from the University of Copenhagen. ... is important that each treatment is dosed correctly. Basically, ...
... Johns Hopkins scientists have engineered cells that behave like ... on one or more unique inputs. This feat, published in ... eventually help researchers create computers that use cells as tiny ... in the Department of Cell Biology and member of the ...
... BETHESDA, MD May 30, 2012 The Genetics Society ... six graduate students and seven postdoctoral researchers as recipients of ... Each of these early-career geneticists receives a $1,000 travel award ... in a laboratory course of their choice that will enhance ...
Cached Biology News:Blanch your weeds 2Training cells to perform Boolean functions? It's logical 2Training cells to perform Boolean functions? It's logical 3The Genetics Society of America announces DeLill Nasser Travel Award recipients 2
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
... kit contains sufficient materials for 1,464 array sample elements. ... 4 each , Blocker BSA in PBS (10X): ... , BupH Phosphate Buffered Saline: 8 packs ... SuperSignal West Pico Luminol Enhancer: 2 x 25 ml ...
Biology Products: