Navigation Links
TriLink BioTechnologies Announces Worldwide License with QuantiBact A/S, Copenhagen, Denmark
Date:5/9/2013

SAN DIEGO, May 9, 2013 /PRNewswire/ -- TriLink BioTechnologies, Inc. (TriLink, www.trilinkbiotech.com), a leader in manufacturing high quality oligonucleotides, nucleoside triphosphates and mRNA, announced that it has signed a licensing agreement with QuantiBact A/S (QuantiBact, www.quantibact.com) to offer twisted intercalating nucleic acid (TINA) modified oligos.

TINA molecules are intercalators placed at the 5' end of primers to stabilize duplex formation. Their unique properties improve the sensitivity and specificity of endpoint and real-time PCR. TINA may find applications wherever an enhanced Tm is required such as triplex formation or potentially even gene silencing.

"At QuantiBact we strive to make our technologies available throughout the research and diagnostic communities. We appreciate being able to work with dedicated companies that hold high recognition in the market place. The market position as well as in depth knowledge of nucleic acids embedded within TriLink will enable us to further reach our goal," says Palle Schelde , CEO, Managing Director, QuantiBact.

"At TriLink we pride ourselves on our quality and our ability to handle unique nucleic acid modifications. This makes us an ideal manufacturer of TINA oligos," stated Richard Hogrefe , Ph.D., President and CEO of TriLink. "We are excited to work with the great folks at QuantiBact and see how this technology might advance molecular diagnostics."

TINA modified oligonucleotides will be available from TriLink in June, 2013. Visit www.trilinkbiotech.com/TINA for the most up-to date information.

About QuantiBact
QuantiBact develops novel generic nucleic acid tools for research and diagnostic use. The objective of the technology
'/>"/>

SOURCE TriLink BioTechnologies, Inc.
Copyright©2012 PR Newswire.
All rights reserved

Page: 1 2

Related biology technology :

1. TriLink BioTechnologies Awards Keck Science Department ResearchReward
2. Leading Scientists to Debate Views on Rejuvenation Biotechnologies
3. Lifeline Biotechnologies Receives Patent for Methods to Collect and Analyze Breast Thermal Data to Determine Suspect Conditions
4. Medical Marijuana, Inc. Portfolio Company CanChew BioTechnologies Inc. Updates and Expands Free Product Trial
5. Adaptive Biotechnologies launches clonoSEQ, a more sensitive, accurate assay to detect minimal residual disease (MRD) in blood-based cancers.
6. OPX Biotechnologies Selected as Innovation Pioneer at IHS CERAWeek
7. Adaptive Biotechnologies Signs Biomarker Discovery Collaboration Agreement with Bristol-Myers Squibb
8. Keryx Biopharmaceuticals, Inc. Announces Upcoming Poster Presentations of Zerenex™ (Ferric Citrate) at the Upcoming American Society of Nephrology Kidney Week 2011 Annual Meeting
9. VaxyGen Assay Services, LLC Announces Launch of Custom Bioassay Services and Operations
10. Sequenom Announces Participation at the Lazard Capital Markets 8th Annual Healthcare Conference
11. ACORN Research, LLC Announces Partnership with AdeptBio, LLC
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:5/21/2015)... 2015 W. R. Grace & ... in Worms, Germany has received good manufacturing practice ... the International Pharmaceutical Excipient Council (IPEC) Foundation. ... its SYLOID® FP brand of pharmaceutical grade excipient ... the Curtis Bay, Maryland (USA) and Sorocaba, Brazil ...
(Date:5/21/2015)... 2015 Research and Markets ( ... "2015 Global Survey on Flow Cytometry Adoption ... The primary goal of this research is to ... reagents. Key information the survey seeks to collect ... cytometers, predominantly used applications for flow cytometers, respondents, ...
(Date:5/20/2015)... , May 20, 2015 Veracyte, ... preliminary data demonstrating the ability of the company,s ... (IPF) from other interstitial lung diseases (ILDs) using ... classifier,s potential to help thousands of patients avoid ... in IPF diagnosis – a frequent challenge for ...
(Date:5/20/2015)... Pa. , May 20, 2015  Select ... that the Federal Trade Commission granted early termination ... Antitrust Improvements Act of 1976, as amended, applicable ... MJ Acquisition Corporation, a joint venture that Select ... L.P. As previously announced, MJ Acquisition ...
Breaking Biology Technology:Grace European Facility Receives GMP Excipient Certification for SYLOID® FP Silica Gel 2Global Survey on Flow Cytometry Adoption Trends 2015 2Veracyte Presents Preliminary Data Demonstrating Ability of Molecular Classifier to Improve Non-Surgical IPF Diagnosis Using Bronchoscopy Samples 2Veracyte Presents Preliminary Data Demonstrating Ability of Molecular Classifier to Improve Non-Surgical IPF Diagnosis Using Bronchoscopy Samples 3Veracyte Presents Preliminary Data Demonstrating Ability of Molecular Classifier to Improve Non-Surgical IPF Diagnosis Using Bronchoscopy Samples 4Veracyte Presents Preliminary Data Demonstrating Ability of Molecular Classifier to Improve Non-Surgical IPF Diagnosis Using Bronchoscopy Samples 5Select Medical Corporation's Proposed Acquisition of Concentra Inc. through Joint Venture with Welsh Carson Receives Antitrust Clearance 2
... global,specialty biopharmaceutical company announces results for the year to,December 31, 2008 - a year which has seen significant ... ... Q4 2008 (1), Product sales ... 27% $0.70 bn + 7%(3), Product sales, ...
... NEWARK, Del., Feb. 19 Lightwave Logic, Inc. (OTC ... technology company focused on the development of electro-optic polymer ... optical computing, announced today the addition of Anthony J. ... for 30 years in medicinal chemistry and brings a ...
... most widely used drugs, is also one of the trickiest ... risk of serious problems when given the standard starting dose. ... medicine" based on genetic information, an international research team has ... of the blood-thinning drug for each patient. , Three ...
Cached Biology Technology:Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 2Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 3Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 4Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 5Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 6Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 7Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 8Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 9Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 10Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 11Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 12Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 13Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 14Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 15Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 16Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 17Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 18Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 19Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 20Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 21Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 22Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 23Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 24Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 25Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 26Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 27Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 28Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 29Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 30Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 31Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 32Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 33Lightwave Logic, Inc. Announces the Addition of Anthony J. Cocuzza, PhD to its Technology Team 2Genetic information personalizes warfarin prescribing 2Genetic information personalizes warfarin prescribing 3
(Date:5/19/2015)... , May 19, 2015 ... has announced the addition of the  "Genetic ... offering.  ,     (Logo: http://photos.prnewswire.com/prnh/20130307/600769) , ,A recent ... an in-depth analysis of the current and ... of gene-based tests, their working principles and ...
(Date:5/14/2015)... NEW YORK , May 14, 2015 ... specializing in identity verification and online remote ... Instructure, a software-as-a-service (SaaS) company and creator ... Shared customers of the two companies will ... Proctortrack in Canvas. As a ...
(Date:5/11/2015)... Curemark LLC, a privately held drug research ... Phase III double blind, randomized, placebo-controlled clinical trial to ... all children ages 3-8 with Autism. Previously, Curemark announced ... blinded clinical trial for CM-AT in children ages 3-8 ... enzyme chymotrypsin. This new trial will help determine whether ...
Breaking Biology News(10 mins):Global Genetic Testing Market Outlook 2018 2Verificient and Instructure Announce Alliance Partnership to Provide Online Proctoring for K-12 and Higher Education Institutions 2Curemark, LLC, Launches New Phase III Trial in Expanded Population of Children with Autism 2
... care laws to protect patients, privacy make it nearly ... the safety and usability of medical products by observing ... usability errors and hazards may be overlooked, with the ... Ergonomics in Design, human factors/ergonomics researchers found ...
... between chemicals called phthalates and thyroid hormone levels was ... large-scale and nationally representative study of phthalates and BPA ... The U-M School of Public Health study also reported ... a chemical called bisphenol-A and thyroid hormone levels. BPA ...
... sources of social and emotional support for "everyday people," not ... by the American Psychological Association. And, the study ... in their lives as to their animals, indicating no evidence ... with other people, or that people relied more on pets ...
Cached Biology News:Large human study links phthalates, BPA and thyroid hormone levels 2The truth about cats and dogs: Pets are good for mental health of 'everyday people' 2
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... Mouse polyclonal antibody raised against a partial ... FES (AAH35357, 120 a.a. ~ 250 a.a) ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
... antibody raised against a partial ... Immunogen: PPP4C (NP_002711, 218 ... recombinant protein with GST tag. ... NM_002720 ...
Mouse monoclonal antibody raised against a partial recombinant CAPG. NCBI Entrez Gene ID = CAPG...
Biology Products: