Navigation Links
Syngenta Opens Unique $72 Million Advanced Crop Lab
Date:5/17/2013

RESEARCH TRIANGLE PARK, N.C., USA (PRWEB) May 17, 2013

•    First of its kind research facility

  •     Green Globes Certified for sustainability
  •     New facility will help solve crop stresses of drought and insect pressures

Syngenta unveiled its new crop research facility during a grand opening celebration today at the company’s RTP Innovation Center. The first of its kind, $72 million Advanced Crop Lab allows company researchers to simulate any agricultural climate and precisely measure plant inputs – the key to helping farmers grow more food from fewer resources.

“Our new Advanced Crop Lab allows us to bring together components of all research where we can create environments for multiple crops from multiple regions — simultaneously,” said Michiel van Lookeren Campagne, head of biotechnology for Syngenta. “Individual controls of temperature, light and carbon dioxide levels, as well as humidity control in many growth chambers, provide tailored environments that allow our talented researchers to work on specific grower challenges. In addition to innovative facilities, being in RTP, we have access to some of the greatest scientific minds to help farmers grow more from less.”

Housing 30 climate-controlled growth environments in all-glass greenhouses, Syngenta can simulate conditions from Iowa in one room and from Africa right next to it. This flexibility allows company researchers to focus on developing agricultural traits that optimize crop yields, use resources efficiently and resist various stresses that farmers face every day across the globe.

During the grand opening, North Carolina Governor Pat McCrory, North Carolina Agriculture Commissioner Steve Troxler, U.S. Senator Kay Hagan, growers and many others tour
'/>"/>

Source: PRWeb
Copyright©2012 Vocus, Inc.
All rights reserved

Page: 1 2 3

Related biology technology :

1. Syngenta and Devgen enter insect control research partnership
2. Syngenta to acquire Pasteuria Bioscience
3. Pasteuria Bioscience to be Acquired by Syngenta
4. Syngenta Secures EU Approval For Next Generation Fungicide
5. Syngenta divests US flowers distribution and brokerage
6. Ceres and Syngenta to Collaborate on Sweet Sorghum Market Development
7. Syngenta Licenses Plant Sensory Systems' Technology
8. Bayer CropScience and Syngenta Submit Herbicide-tolerance Soybean Trait for Approval in Various Countries
9. Syngenta and Bayer CropScience Propose a Comprehensive Action Plan to Help Unlock EU Stalemate on Bee Health
10. Syngenta Holds Annual General Meeting
11. First Free-Standing International Mesothelioma Research Laboratory Opens in Los Angeles
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:11/18/2014)... (PRWEB) November 18, 2014 Brothers Josh ... the launch of PAWSitively Curing Cancer, Inc . ... new 501(c) (3) non-profit organization is dedicated to raising ... goes directly to the University of Florida College ... with PAWSitively Curing Cancer as the recipient of this ...
(Date:11/18/2014)... 2014  Great Basin Scientific, Inc. (NASDAQ: GBSN ... will host a conference call and webcast to provide an ... Nov. 20, at 4:30 pm EST time. "We ... Company,s recent IPO and would like to provide our investors ... Ryan Ashton , President and Chief Executive Officer of Great ...
(Date:11/16/2014)... 2014 James Hill and Ken Crooks ... Hoods, 3 Years Later” scheduled for Thursday, November 20, ... Butler University surprised many in the lab design domain ... chemistry and general chemistry teaching laboratories at Gallahue Hall. ... age and substantial growth within the chemistry program. Now, ...
(Date:11/15/2014)... Denver, Colorado (PRWEB) November 14, 2014 ... leading provider of proprietary, cloud-based analytics, and scientific ... results for the third quarter ended September 30, ... Quarter 2014 Highlights, ,     CannLabs – ... in Las Vegas, Nevada. ,     CannLabs – ...
Breaking Biology Technology:PAWSitively Curing Cancer, Inc. Launched By Two Children for National Pet Cancer Awareness Month 2PAWSitively Curing Cancer, Inc. Launched By Two Children for National Pet Cancer Awareness Month 3Great Basin Scientific Announces Conference Call to Provide Update on Corporate Progress 2Don't miss the I2SL High-Tech Talks Webinar Series Presenting: Butler University's Renovation With Filtered Fume Hoods, 3 Years Later 2Don't miss the I2SL High-Tech Talks Webinar Series Presenting: Butler University's Renovation With Filtered Fume Hoods, 3 Years Later 3CannLabs Announces Third Quarter 2014 Results. 2CannLabs Announces Third Quarter 2014 Results. 3CannLabs Announces Third Quarter 2014 Results. 4CannLabs Announces Third Quarter 2014 Results. 5
... president of Niceware International , a Milwaukee developer ... Matter has seen identification software used to track parts ... only a matter of time before healthcare facilities came ... founded in 2002, has produced NiceLabel software for the ...
... - In a criminal trial, as any fan of TV ... defense goes second. The accused can appear in deep trouble, at ... often carries the day. , ,Not only does that make for ... works in real life. Those who file the charges speak first, ...
... Milwaukee, Wis . - Midwest Fiber Networks , which ... by March of 2008, has been granted a reprieve by ... the project. , ,The council has voted to give Midwest ... or demonstration area, of the citywide wireless network. The company ...
Cached Biology Technology:Software company enters health space with RFID solutions on hold 2Software company enters health space with RFID solutions on hold 3Here's why Wisconsin's stem cell patents are being challenged 2Here's why Wisconsin's stem cell patents are being challenged 3Here's why Wisconsin's stem cell patents are being challenged 4
(Date:11/2/2014)... World , James Dacey explores the ways in which ... their innovations from the lab into the commercial market. ... start-up companies as they move from prototype to product ... factors: physics-based inventions are usually far from market-ready when ... a lot more complicated than had been originally thought. ...
(Date:11/2/2014)... Feynman walk into a bar and bump into a biologist ... setup to some late-night nerd sketch, researchers have taken this ... modern biology, namely, finding meaning in the rising oceans of ... of cancer mutations that genome-wide studies are publishing at a ... to parse the signal from the noise (and there is ...
(Date:10/31/2014)... still live in Nuristan Province – some 60 years ... scent glands are more valuable than gold , Study ... Oryx , NEW YORK (October 31, 2014) – ... a strange deer with vampire-like fangs still persists in ... a research team led by the Wildlife Conservation Society ...
Breaking Biology News(10 mins):The 'valley of death' facing physics start-ups 2Mutant models 2Mutant models 3Mutant models 4Strange, fanged deer persists in Afghanistan 2
... microbiologist James Holden of the University of Massachusetts Amherst launches ... the cracks and thermal vents around an undersea volcano, for ... will not be funded by a government source. ... oceanographic research: The Gordon and Betty Moore Foundation started by ...
... YORK , Aug. 16, 2013   EyeLock Inc. , a market ... Roger An as Vice President of Global Market ... research, analysis and strategic initiatives to further the embedded applications ... heavy focus on Asia .   ...
... CITY)If terrorists targeted the United States with an anthrax attack, ... such as knowing the likelihood of an individual becoming ... and how long to give antibiotics to protect people ... anthrax-laced letters killed five people and infected 17 others in ...
Cached Biology News:Google, Intel founders support undersea research by UMass Amherst microbiologist 2Google, Intel founders support undersea research by UMass Amherst microbiologist 3EyeLock Appoints Roger An Vice President of Global Market Development 2EyeLock Appoints Roger An Vice President of Global Market Development 3Answering crucial questions about anthrax exposure 2Answering crucial questions about anthrax exposure 3Answering crucial questions about anthrax exposure 4
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
...
... polyclonal antibody raised against a partial recombinant ... (AAH35357, 120 a.a. ~ 250 a.a) partial ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Mouse monoclonal antibody raised against a partial recombinant PRKG1. NCBI Entrez Gene ID = PRKG1...
Biology Products: