Navigation Links
Study by Leading Economist Identifies Potential for $378 Billion of Savings From Follow On Biologics
Date:2/11/2008

RICHMOND, Va., Feb. 11 /PRNewswire-FirstCall/ -- A report released today, commissioned by Insmed Inc. (Nasdaq: INSM), identifies potential cost savings of approximately $378 billion over the next 20 years from making follow on biologics (FOBs) available in the U.S.

The econometric study by economist Dr. Robert J. Shapiro, former Under Secretary of Commerce in the Clinton Administration, found that "...generic versions of the top 12 categories of biologic treatments with patent protections that have expired or that are due to expire in the near future could save Americans $67 billion to $108 billion over 10 years and $236 billion to $378 billion over 20 years."

According to other published reports, an estimated $10 billion worth of biologic drugs are expected to come off patent by 2010, with an additional $10 billion by 2015. FOBs would provide safe and effective therapies at a reduced cost following the expiration of the original product's patent.

Dr. Shapiro's report, entitled The Potential American Market for Generic Biological Treatments and the Associated Cost Savings, also finds that "...the economic and medical benefits from generic biologics should be as great or perhaps even greater as those from generic forms of traditional pharmaceuticals... Moreover, the potential savings from the discounted prices that generics provide will be larger with biogenerics, because original biologics are so much more expensive than other brand pharmaceuticals..."

The scientific, regulatory and legal framework for the approval of small- molecule generic drugs is well developed, and a regulatory system for approving FOBs was established in Europe in 2006. However, no regulatory pathway currently exists for FOBs, which are a
'/>"/>

SOURCE Insmed Inc.
Copyright©2008 PR Newswire.
All rights reserved

Page: 1 2 3 4 5

Related biology technology :

1. Dendreon Announces Publication of Phase 1 Study Highlighting Immunologic and Clinical Activity of Lapuleucel-T (Neuvenge(R)) in Advanced Breast Cancer Patients
2. Cephalon Announces Positive Results from a Pivotal Study of FENTORA in Opioid-tolerant Patients with Non-cancer Breakthrough Pain
3. Kline Study: Better Brushing Habits Boost European Oral Care Sales
4. Evotec to Present Details of the Positive Phase II Study in Insomnia With EVT 201 at the Worldsleep07 Congress in Cairns/Australia
5. NASA study will help stop stowaways to Mars
6. New Study Findings Confirm CLEXANE(R)/LOVENOX(R) Long-Term Clinical Benefit in Patients Suffering From Acute Coronary Syndrome
7. Study Published in Clinical Cancer Research Confirms Potential Of Peregrines Bavituximab Combined With Radiation In Lung Cancer
8. Evotec Reports Details of the Positive Proof-of-Concept Phase II Study in Insomnia With EVT 201
9. Study Supports Use of GlycoMark Blood Test to Evaluate Therapy in Children with Diabetes
10. Quigley Corporation Releases Update on Quigley Pharmas Phase IIb Clinical Study of QR-333 in Diabetic Peripheral Neuropathy
11. Biodel Inc. Announces VIAject(TM) Phase II Meal Study Data at the 2007 European Association for the Study of Diabetes Meeting
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:12/17/2014)... December 16, 2014 The Activated ... 2013, which is why IBISWorld updated its original industry ... to benefit from an intensified focus on environmental policy. ... new emission standards for power plants and a range ... to IBISWorld Industry Analyst Sarah Kahn, “a range of ...
(Date:12/17/2014)... Washington, USA (PRWEB) December 16, 2014 ... Baum, manager at Philipps- Universität Marburg’s Department of ... and photonics, in the newly released SPIE ... “And never be too shy to ask questions.” ... (science, technology, engineering, and mathematics) occupations ranging from ...
(Date:12/17/2014)... December 17, 2014 Ipsen Biopharmaceuticals, ... IPN; ADR: IPSEY), today announced that ... as Somatuline®) was approved by the U.S. Food ... gastroenteropancreatic neuroendocrine tumors (GEP-NETs) in adult patients with ... metastatic disease to improve progression-free survival (PFS). , ...
(Date:12/17/2014)... This report is a professional ... For an overview analysis, the report introduces quartz ... structure, industry overview, policy analysis, and news analysis, ... has witnessed rapid development with key manufacturers increasing ... report mentions quartz tubing upstream raw materials and ...
Breaking Biology Technology:Activated Carbon Manufacturing in the US Industry Market Research Report Has Been Updated from IBISWorld 2Activated Carbon Manufacturing in the US Industry Market Research Report Has Been Updated from IBISWorld 3Network, Multitask, Persevere: SPIE Women in Optics Planner Subjects Share from Experience 2Network, Multitask, Persevere: SPIE Women in Optics Planner Subjects Share from Experience 3Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 2Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 3Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 4Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 5Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 6Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 7Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 82020 Quartz Tubing Market: Global Development & Forecasts Analysis Now at DeepResearchReports.com 2
... BioMed Realty Trust, Inc. (NYSE: BMR ), a real ... Science Industry®, today announced financial results for the third quarter ended ... Generated record total revenues for the third quarter of ... in 2009. Increased rental revenues for the third quarter by ...
... to develop relatively advanced tools after their brains evolved a ... that investigates why it took early humans almost two million ... axe. Researchers used computer modelling and tiny sensors embedded ... humans needed in order to make two types of tools ...
... New Mexico, NOVEMBER 3, 2010Scientists at the U.S. Department ... Laboratory have fabricated transparent thin films capable of absorbing ... area. The material, described in the journal Chemistry ... transparent solar panels. "Potentially, with future refinement of ...
Cached Biology Technology:BioMed Realty Trust Reports Third Quarter 2010 Financial Results 2BioMed Realty Trust Reports Third Quarter 2010 Financial Results 3BioMed Realty Trust Reports Third Quarter 2010 Financial Results 4BioMed Realty Trust Reports Third Quarter 2010 Financial Results 5BioMed Realty Trust Reports Third Quarter 2010 Financial Results 6BioMed Realty Trust Reports Third Quarter 2010 Financial Results 7BioMed Realty Trust Reports Third Quarter 2010 Financial Results 8BioMed Realty Trust Reports Third Quarter 2010 Financial Results 9BioMed Realty Trust Reports Third Quarter 2010 Financial Results 10BioMed Realty Trust Reports Third Quarter 2010 Financial Results 11BioMed Realty Trust Reports Third Quarter 2010 Financial Results 12BioMed Realty Trust Reports Third Quarter 2010 Financial Results 13BioMed Realty Trust Reports Third Quarter 2010 Financial Results 14BioMed Realty Trust Reports Third Quarter 2010 Financial Results 15BioMed Realty Trust Reports Third Quarter 2010 Financial Results 16BioMed Realty Trust Reports Third Quarter 2010 Financial Results 17Stone Age humans needed more brain power to make big leap in tool design 2Scientists produce transparent, light-harvesting material 2
(Date:12/11/2014)... 2014  Data Sciences International (DSI), the global ... new series of digital telemetry implants to meet ... series, part of the PhysioTel™ Digital platform, was ... physiologic data when incorporating functional endpoints into repeat-dose ... toxicology studies has evolved from short ECG strips ...
(Date:12/10/2014)... DIEGO , Dec. 9, 2014 CIE ... collaboration catalyst that provides the connective tissue that enhances ... enabling them to easily share client-level information; earned a ... to expand to organizations serving seniors aging in community ... Diego" partner on December 11 th 4-6p. ...
(Date:12/5/2014)... , Dec. 4, 2014  Tute Genomics, a leader ... million in Series A1 funding led by UK-based Eurovestech. ... participated in the investment round. "We are ... community adopts next-generation sequencing and seeks new approaches for ... Reid Robison , MD MBA, and CEO of Tute ...
Breaking Biology News(10 mins):New telemetry implants expected to change how large animal toxicology studies are conducted 2Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 2Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 3Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 4Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 2Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 3
... You don,t need to spray weedkiller to remove the ... with either boiling water, steam or flaming will dispatch even ... a new PhD project from the University of Copenhagen. ... is important that each treatment is dosed correctly. Basically, ...
... Johns Hopkins scientists have engineered cells that behave like ... on one or more unique inputs. This feat, published in ... eventually help researchers create computers that use cells as tiny ... in the Department of Cell Biology and member of the ...
... BETHESDA, MD May 30, 2012 The Genetics Society ... six graduate students and seven postdoctoral researchers as recipients of ... Each of these early-career geneticists receives a $1,000 travel award ... in a laboratory course of their choice that will enhance ...
Cached Biology News:Blanch your weeds 2Training cells to perform Boolean functions? It's logical 2Training cells to perform Boolean functions? It's logical 3The Genetics Society of America announces DeLill Nasser Travel Award recipients 2
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
... kit contains sufficient materials for 1,464 array sample elements. ... 4 each , Blocker BSA in PBS (10X): ... , BupH Phosphate Buffered Saline: 8 packs ... SuperSignal West Pico Luminol Enhancer: 2 x 25 ml ...
Biology Products: