Navigation Links
Sigma-Aldrich (Nasdaq: SIAL) Annual Sales Surpass $2 Billion Mark.
Date:2/12/2008

t initiatives. Internet promotions and interactions helped drive sales growth in all geographic regions, and intentional inventory increases and new supplier relationships to better serve CAPLA markets continued to fuel double-digit organic growth for Research Specialties and the Company's other research business units in these markets.

Research Essentials (Reported growth: Q4: 11.8%, 2007: 9.2%; Organic growth: Q4: 5.0%, 2007: 4.6%): Overall Q4 2007 organic sales growth paralleled that of the two preceding 2007 quarters, delivering results that beat long-term expectations for the third successive quarter and the year. Sales to pharmaceutical accounts in the U.S. and CAPLA remained strong in particular, as did overall sales to CAPLA customers. Customer centric marketing programs aimed at serving pharmaceutical customers and their contract research organizations wherever located around the globe continued to gain traction. Within Research Essentials' overall growth rate, the cell culture and lab essentials product initiatives were the major contributors to the Q4 2007 growth.

Research Biotech (Reported growth: Q4: 11.3%, 2007: 8.1%; Organic growth: Q4: 4.4%, 2007: 3.7%): As expected, improved sales growth at nearly a 6% rate over the final half of the year was driven by stronger spending by academic customers in Europe and by double-digit Q4 2007 growth in molecular biology and peptides products in both the U.S. and Europe. The addition of sales specialists earlier in the year and ongoing expansion of product offerings through internal development efforts and technology licenses contributed to this resurgent growth. Though pricing for synthetic DNA products remained consistent with that experienced in recent quarters, demand for oligos was down in both the U.S. and Japan during the fourth quarter, dampening this unit's otherwise reportable results.

SAFC (Fine Chemicals; Reported growth: Q4: 16.8%, 2007: 19.1%; Organic growth: Q4: 3.2%, 2007: 7.1%
'/>"/>

SOURCE Sigma-Aldrich Corporation
Copyright©2008 PR Newswire.
All rights reserved

Page: 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20

Related biology technology :

1. Sigma-Aldrich (Nasdaq: SIAL) Declares Quarterly Dividend
2. Sigma-Aldrich and Lab Manager Magazine Present Webinar On Laboratory Environmental, Health and Safety Compliance Strategies
3. Sigma-Aldrich Expansion in Republic of China to Support SAFC Growth
4. Sigma-Aldrich and Ingenuity Systems Announce Partnership to Create E-Commerce Search Solution Based on Biological Knowledge
5. Sigma-Aldrich to Present at the UBS 2007 Global Life Sciences Conference on September 25, 2007
6. Sigma-Aldrich Names Patrick Sullivan New VP of Research and Development for Research Biotech
7. Sigma-Aldrich and the Universite de Montreal Establish Collaboration for RNA Interference Studies
8. Sigma-Aldrich Corporations 3rd Quarter 2007 Earnings Conference Call
9. Sigma-Aldrich Introduces N-TER Nanoparticle siRNA Transfection System for Delivery of siRNA Into Difficult-to-Transfect Cell Types
10. Sigma-Aldrich (Nasdaq: SIAL) Q3 2007 Sales Increase 14.0%, Yielding Diluted EPS of $.54.
11. Sigma-Aldrich and Oxford BioMedica Win Key Ruling in Open Biosystems Patent Infringement Dispute
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:11/22/2014)... 21, 2014   ... Commercial Officer zu KLOX    ... Chief Financial Officer bestellt    KLOX ... seines jüngst zugelassenen Behandlungssystems zur Wundheilung zu beginnen    ... "Unternehmen") ist sehr erfreut, die folgenden personellen Veränderungen anzukündigen: ...
(Date:11/21/2014)... BELLINGHAM, Washington, USA (PRWEB) November 19, 2014 ... used in our lives was shared with more than ... undergraduate and postgraduate students from the University of Otago ... Outreach Grant . The Otago students, members of the ... Southland New Zealand in early September, giving children from ...
(Date:11/21/2014)... 20, 2014 The California ... research organization representing leading California academic institutions, biotechnology, ... PwC US today released a report revealing ... industry growth. The trend shows a 4 percent ... California Biomedical Industry Report indicates that, while ...
(Date:11/21/2014)... Fayetteville, Arkansas (PRWEB) November 20, 2014 ... partners, Pinnacle Ozone Solutions, LLC (Pinnacle), and PCI, ... equipment, announced that they have been selected to ... City of Fayetteville, Arkansas Paul R. Noland Wastewater ... feature BlueInGreen’s patented HyDOZ® gas dissolution ...
Breaking Biology Technology:KLOX Technologies meldet Neubesetzung von Führungspositionen 2KLOX Technologies meldet Neubesetzung von Führungspositionen 3KLOX Technologies meldet Neubesetzung von Führungspositionen 4KLOX Technologies meldet Neubesetzung von Führungspositionen 5Optics and photonics outreach programs share science, spark fascination with light 2Optics and photonics outreach programs share science, spark fascination with light 3California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 2California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 3California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 4City of Fayetteville Leads Nation with Innovative Ozone Technology 2City of Fayetteville Leads Nation with Innovative Ozone Technology 3City of Fayetteville Leads Nation with Innovative Ozone Technology 4
... veteran, was promoted to president of the General Electric Medical ... who left to become CEO at Invitrogen. The division focuses ... systems . , ,It's a dream job for a corporate ... about $9 billion and produced GE CEO and Chairman Jeffery ...
... develops and sells employee scheduling and management products. The ... and co-founder of Suite Scheduler, a former nurse manager ... employees in a facility. , ,Suite Scheduler products are ... up to 90% of the time to create and ...
... That is, until he gets to the better drugs, faster ... the science behind the Madison-based companys products is likely to ... nears the age when diseases and treatments become as common ... the two and a half-year-old company that Vodenlich joined as ...
Cached Biology Technology:CEO Wilson Defines GE's Health-IT Customer 2CEO Wilson Defines GE's Health-IT Customer 3CEO Wilson Defines GE's Health-IT Customer 4Scheduling made easy with Suite Scheduler 2Scheduling made easy with Suite Scheduler 3Chipping Away at Drug Development 2Chipping Away at Drug Development 3
(Date:11/18/2014)... , Nov. 18, 2014   EyeLock Inc. ... solutions, and MorphoTrust USA (Safran), a ... today announced a strategic partnership to offer comprehensive ... vehicle administration (MVA), airport screening and financial services ... solutions, MorphoTrust serves consumers through a nationwide network ...
(Date:11/11/2014)... , Nov. 11, 2014  Forensicon, Inc., a ... firm, is pleased to announce the promotion of ... Director of Digital Forensics. In Schiff,s new role as ... the team of digital forensics examiners and provide leadership ... Photo - http://photos.prnewswire.com/prnh/20141110/157719 ...
(Date:11/7/2014)... Calif. , Nov. 7, 2014  In conjunction with ... Police Departments, The Community Foundation of the Verdugos ... DNA JUSTICE PROJECT," a $250,000 initiative to keep ... initial phase. In its first six months of existence, the ... needed evidence support for local law enforcement. "Because ...
Breaking Biology News(10 mins):EyeLock, MorphoTrust Form Strategic Partnership to Pursue Commercial Enterprise Deployments 2EyeLock, MorphoTrust Form Strategic Partnership to Pursue Commercial Enterprise Deployments 3Yaniv Schiff Promoted to Director of Digital Forensics at Forensicon, Inc. 2Community Foundation Of The Verdugos Unveils Campaign To Fund Glendale-Burbank DNA Justice Project 2
... February 26, 2013, New York, N.Y. and San Diego, Calif. ... tumor in adults, is challenging to treat because the tumors ... more about the causes of tumor cell growth and drug ... new targeted therapies to potentially treat this deadly cancer. ...
... 2013, Reston, VAResearchers will meet at the Society of ... a number of health concerns that have received growing ... of the presentations, scientists will explore how the development ... related exposures might affect the risk assessment of arsenic ...
... Rockville, Md. The Association for Research in Vision ... three keynote speakers, including two Nobel laureates, during the ... Wash. New this year, the ARVO/Alcon Keynote Series ... Christopher Murray, MD, DPhil. Smithies, of the University ...
Cached Biology News:Novel combination therapy shuts down escape route, killing glioblastoma tumor cells 2Scientists explore topical health issues at meeting in Texas 23 distinguished keynote speakers to present during ARVO 2013 Annual Meeting 2
... a partial recombinant FES. ... 250 a.a) partial recombinant protein with GST ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: BC035357 ... AAH35357 OMIM: 190030, ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
... sufficient materials for 1,464 array sample elements. , , ... , Blocker BSA in PBS (10X): 50 ml ... BupH Phosphate Buffered Saline: 8 packs , 10% ... Pico Luminol Enhancer: 2 x 25 ml , SuperSignal ...
Biology Products: