Navigation Links
Save Space with Scienceware® Switch-Grid™ Test Tube Racks by Bel-Art Products
Date:2/1/2013

Wayne, NJ (PRWEB) February 01, 2013

As space in the lab becomes increasingly limited, consolidating different size test tubes within one rack frame can make benchtop and storage areas less cluttered.

The new Scienceware® Switch-Grid™ Test Tube Rack enables storage of up to two size tubes at one time with 25 possible tube size combinations, all in one rack. The result is much more compact and less expensive than multiple single racks. It gives users more room to work and fewer racks to store.

“There are racks available which allow for different sizes of tubes to be carried in the same rack, but they tend to be fixed and not interchangeable. Therefore, the end user must purchase multiple racks in order to accommodate many different tube sizes,” according to Laura Geenen, Product Manager for Bel-Art Products. “With Scienceware® Switch-Grid™ Test Tube Racks, fewer racks are needed.”

Each rack is divided into two sides allowing the same or different size tube grids to be used in each side. The grids can be removed and replaced in seconds and are available in 5 color coded sizes to fit tubes from 10mm to 30mm.

The chemical-resistant plastic rack frame and grids can be cleaned easily and are autoclavable. Rubber feet help keep the racks from sliding on the benchtop and provide secure stacking while in storage.

The suggested list price for one rack with a set of 4 grids in a single size is $19.50. Grids can be swapped between racks, or extra grid packs in orange (10-13mm), blue (13-16mm), green (16-20mm), fuchsia (20-25mm), or yellow (25-30mm) are available for $5.00 per pack of four.

To see the Scienceware® Switch-Grid™ Test Tube Rack in action, visit the <
'/>"/>

Source: PRWeb
Copyright©2012 Vocus, Inc.
All rights reserved

0

GOOD

Page: 1 2

Related biology technology :

1. BioSpace Releases 2013 Life Sciences / Biotech Employment Outlook
2. Space Dive Filming, 3D Olympics Coverage Among Highlights at IS&T/SPIE Electronic Imaging Next Month
3. NASAs robotic refueling demo set to jumpstart expanded capabilities in space
4. The Honey Drop, the Ultimate Fuel for Astronauts, will be Powering Commander Chris Hadfield's Mission to the International Space Station
5. Space-age ceramics get their toughest test
6. CoreLab Partners, Medical Image Assessment Experts, Announces Its Entry Into the Early Alzheimers Imaging Market Space
7. Chemical Publishing Company Announces its Niche Catalog in the Water Technology and Water Treatment Space
8. BioSpace Spotlights Northwests Life Science Community
9. NRL demonstrates high durability of nanotube transistors to the harsh space environment
10. BioSpace Spotlights Thriving Bay Area Life Science Community
11. NSBRI Renews Space Life Sciences Graduate Programs at MIT, Texas A&M
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:6/19/2013)... Today DuPont Executive Vice President James C. Borel ... greatest challenge facing our time – ensuring food security ... at the International Food and Agribusiness Management Association ... students to contribute their time and talents to create ... collaboration with others. , “Food is one of the ...
(Date:6/19/2013)... India’s vast and growing population ... worth up to a billion dollars per year ... is taking serious action to better regulate and ... presentation will examine:, ,     Recent changes ... and long term impacts ,     Foreseeable opportunities ...
(Date:6/19/2013)... Adding to their already extensive supply ... Simport’s Dropette® and Heathrow Scientific disposable plastic ... basic biology, chemistry and any type of liquid handling ... 35 years, Simport has been supplying the science community ... the Simport Dropette®. Simport’s Dropette® is a one-piece ...
(Date:6/18/2013)... New York, NY (PRWEB) June 18, 2013 ... technological innovation and sustainability, the Consulate General of Switzerland ... largest solar boat, Switzerland’s MS Tûranor PlanetSolar , ... as part of its DeepWater Expedition 2013 tour with ... catamaran, led by Capitain Gérard d’Aboville, runs exclusively on ...
Breaking Biology Technology:DuPont Leader Calls for New Generation of Food Visionaries to Fight Hunger 2Leading Pipette Distributor Pipette.com Now Stocks Transfer Pipettes: Simport’s Dropette and Heathrow Scientific Disposable Plastic Transfer Pipettes 2Switzerland’s MS Tûranor PlanetSolar, the World’s Largest Solar Boat, Arrives in New York City 2Switzerland’s MS Tûranor PlanetSolar, the World’s Largest Solar Boat, Arrives in New York City 3Switzerland’s MS Tûranor PlanetSolar, the World’s Largest Solar Boat, Arrives in New York City 4
... MOUNTAIN VIEW, Calif., Jan. 17, 2012  MAP Pharmaceuticals, Inc. (Nasdaq: ... James O,Shea to its Board of Directors. Mr. O,Shea brings ... product commercialization and operations. "We are privileged to ... time in the Company,s development as we focus our efforts ...
... 16, 2012 Luminex Corporation (Nasdaq: LMNX ) ... fourth quarter and full year 2011 on Monday, February 6, ... release after the close of trading. (Logo: ... conference call to discuss the operating highlights and financial results ...
... 2012 Elsevier, a world-leading provider ... services, announced today that its first bilingual platform of ... , is now available online. NursingChina ... available in China, featuring skills within specialties such ...
Cached Biology Technology:MAP Pharmaceuticals Appoints W. James O'Shea to Board of Directors 2MAP Pharmaceuticals Appoints W. James O'Shea to Board of Directors 3Luminex Corporation Fourth Quarter and Full Year 2011 Earnings Release Scheduled for February 6, 2012 2Luminex Corporation Fourth Quarter and Full Year 2011 Earnings Release Scheduled for February 6, 2012 3Elsevier Launches Bilingual International Nursing Skill Training and Management Platform: NursingChina.com 2Elsevier Launches Bilingual International Nursing Skill Training and Management Platform: NursingChina.com 3
(Date:6/19/2013)... mystery of how pearls form into the most perfectly ... explanation, scientists are proposing in a new study. It ... 1932 Nobel Laureate Irving Langmuir. , Julyan Cartwright, Antonio ... most flawless and highly prized pearls have perhaps the ... objects in nature that are visible without a microscope. ...
(Date:6/19/2013)... Cornell University study offers further proof that the divergence ... million years ago was profoundly influenced by mutations to ... and off. , The study, published June 9 in ... hypothesis that regulation of genes must play an important ... humans and chimps in the proteins produced by genes. ...
(Date:6/19/2013)... (EMA) approved the modified adeno-associated virus AAV-LPL S447X ... use in the Western world. uniQure, a Dutch ... treatment of a rare inherited metabolic disease called ... or two out of one million people. The ... Afflicted individuals carry a defect in the gene ...
Breaking Biology News(10 mins):New research backs theory that genetic 'switches' play big role in human evolution 2New research backs theory that genetic 'switches' play big role in human evolution 3No danger of cancer through gene therapy virus 2
... in biomedical science are on the horizon with ... Infrastructure (Instruct) in support of European biomedical research. ... (ESFRI) is involved in establishing about 40 such ... is one such biomedical project, whose aim is ...
... center responsible for responding goes into gear, setting off a ... from the adrenal glands. Dr. Gil Levkowitz ... now revealed a new kind of ON-OFF switch in the ... from the brain that stimulates cortisol release in the body. ...
... by a University of California, Davis, plant scientist delivers a ... world-renowned wine industry. The study is set for publication ... the Proceedings of the National Academy of Sciences. "Many ... plant, but we believe that most microbes would have difficulty ...
Cached Biology News:European Integrated Structural Biology Infrastructure launching 2A unique on-off switch for hormone production 2Fused genes tackle deadly Pierce's disease in grapevines 2
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Mouse monoclonal antibody raised against a full length recombinant GPT. NCBI Entrez Gene ID = GPT...
Rabbit polyclonal antibody to GluR2...
Biology Products: