Navigation Links
SGX Pharmaceuticals Announces Financial Results for the Three and Six Months Ended June 30, 2008
Date:8/7/2008

04 3,889

Other assets 4,286 4,284

Total assets $33,637 $51,056

Liabilities and stockholder's equity

Current liabilities $9,676 $24,991

Deferred revenue, long-term 792 1,042

Stockholder's equity 23,169 25,023

Total liabilities and stockholder's equity $33,637 $51,056 (1) In addition to disclosing financial results calculated in accordance

with generally accepted accounting principles (GAAP), this table

contains non-GAAP financial measures that exclude the effect of

non-cash stock compensation expense. The Company believes

that the presentation of results excluding non-cash stock compensation

expense provides meaningful supplemental information to both management

and investors that is indicative of the Company's core operating

results. The Company believes these non-GAAP financial measures

facilitate comparison of operating results across reporting periods,

and uses these non-GAAP financial measures when evaluating its

financial results, as well as for internal planning and forecasting

purposes. These non-GAAP financial measures should not be considered

a substitute for, or superior to, financial measures calculated in

accordance with GAAP.


'/>"/>
SOURCE SGX Pharmaceuticals, Inc.
Copyright©2008 PR Newswire.
All rights reserved

Page: 1 2 3 4 5 6 7 8 9

Related biology technology :

1. ISTA Pharmaceuticals Reports Second Quarter 2008 Financial Results
2. Keryx Biopharmaceuticals, Inc. to Hold Conference Call on Second Quarter 2008 Financial Results on Monday, August 11, at 8:30 A.M. EDT
3. Memory Pharmaceuticals to Announce Second Quarter 2008 Results on Wednesday, August 13, 2008
4. Watson Pharmaceuticals Reports Second Quarter 2008 Results
5. Onyx Pharmaceuticals Reports Second Quarter and Six-Month 2008 Financial Results
6. Arena Pharmaceuticals Announces Second Quarter 2008 Financial Results and Recent and Second Quarter Highlights
7. Marinus Pharmaceuticals Appoints John Krayacich as President and Chief Executive Officer
8. Cadence Pharmaceuticals CEO Theodore Schroeder to Present at Two Investment Conferences During the Month of August 2008
9. Kowa Company, Ltd. Acquires ProEthic Pharmaceuticals, Inc.
10. Lilly Reaffirms Purchase Offer for SGX Pharmaceuticals
11. Anacor Pharmaceuticals Appoints Dr. Kurt Jarnagin Vice President of Biological Research
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:12/17/2014)... (PRWEB) December 17, 2014 Gene ... that it has entered into a technology access ... (ADM) to apply DNA2.0’s proprietary protein engineering technology, ... process. , “We are extremely excited that the ... platform. This proprietary bioengineering technology has now ...
(Date:12/17/2014)... SOUTH SAN FRANCISCO, Calif. , Dec. 17, ... positive results of a Phase 2 study evaluating ... for the treatment of patients with severe, chronic ... the current standard of care, including topical steroids ... endpoint was percent change in Visual Analog Scale ...
(Date:12/15/2014)...  GlassesOff Inc. (OTCBB: GLSO) announced today the appointment ... director of the Company,s Board of Directors. ... its CEO until its acquisition by Stanley Black ... Recognized as the inventor of the first Wi-Fi-based Active ... -based RFID solutions focused on improving operational efficiency, safety ...
(Date:12/13/2014)... (PRWEB) December 12, 2014 Clarassance, a ... announced its new name: Therabron Therapeutics , Inc. ... and bronchioles (a type of structure in the lungs ... company’s mission to develop novel protein therapeutics for the ... directors decided to change the name to mark the ...
Breaking Biology Technology:ADM and DNA2.0 Enter Into Protein Engineering Technology Access and Service Agreement 2Velocity Pharmaceutical Development, LLC and Tigercat Pharma, Inc. Announce Phase 2 Results for VPD-737 in Patients With Chronic Pruritus 2Velocity Pharmaceutical Development, LLC and Tigercat Pharma, Inc. Announce Phase 2 Results for VPD-737 in Patients With Chronic Pruritus 3Velocity Pharmaceutical Development, LLC and Tigercat Pharma, Inc. Announce Phase 2 Results for VPD-737 in Patients With Chronic Pruritus 4AeroScout Founder Joins GlassesOff's Board of Directors 2AeroScout Founder Joins GlassesOff's Board of Directors 3Maryland-based Biotech Company's Path Forward in Treating Respiratory Diseases Sparks Name Change 2
... States Court of Appeals for the Ninth Circuit issued ... v. Netscape Communications Corp. , 9th Cir., No. 00-56648, that ... the Internet. , ,The Playboy case involved "keying," which is ... list of keywords. For instance, a person who searches a ...
... to reboot my washing machine. Not just turning it off ... the power plug from the wall, waited a few moments, ... outlet. Flashing lights, a trill of beeps, and voil: I ... to thinking just how complicated ordinary machines have become, how ...
... joining WTN as a weekly columnist. Her column, The ... opinion articles related to entrepreneurship and venture capital. Particular ... and the lifestyle issues associated with running one's own ... The Millionaire Next Door , which focused on rich ...
Cached Biology Technology:Recent developments in the protection of trademarks on the Internet 2Recent developments in the protection of trademarks on the Internet 3Have you rebooted? 2Have you rebooted? 3Have you rebooted? 4Unique profiles, anecdotes increase Millionaire Womens net worth 2Unique profiles, anecdotes increase Millionaire Womens net worth 3Unique profiles, anecdotes increase Millionaire Womens net worth 4
(Date:12/4/2014)... Fla. , Dec. 3, 2014  Crossmatch™, ... today announced that its DigitalPersona ® Pro ... readers have been deployed throughout First Bank branch ... South Carolina and Virginia. First ... Southern Pines, North Carolina , ...
(Date:11/21/2014)... YORK , Nov. 19, 2014  Earlier this ... at New York College, and one of the most ... biosensor signals that are transmitted from Smartphones to third ... were Smartphones and has one of the earliest known ... discussing its usage in the military, child care, elder ...
(Date:11/18/2014)... -- The Secure Identity & Biometrics Association (SIBA) and ... formation of The Airport Entry and Exit Working ... Biometric Entry and Exit Solutions Framework for Airports ... BORDERPOL, the international non-profit organization that works directly ... border security, traveler and migration systems. ...
Breaking Biology News(10 mins):First Bank Partners with Crossmatch to Increase Log In Security 2First Bank Partners with Crossmatch to Increase Log In Security 3Patented Biosensor Wearable Technology Provides a More Civilized Method of Quarantine 2Patented Biosensor Wearable Technology Provides a More Civilized Method of Quarantine 3Patented Biosensor Wearable Technology Provides a More Civilized Method of Quarantine 4Identity Management, Document Authentication and Biometric Companies Form "The Airport Entry and Exit Working Group", Releasing the Framework to Help Guide the Department of Homeland Security and Congress Towards Solutions 2Identity Management, Document Authentication and Biometric Companies Form "The Airport Entry and Exit Working Group", Releasing the Framework to Help Guide the Department of Homeland Security and Congress Towards Solutions 3
... January 12, 2011 (Toronto) Seven scientists at ... been awarded Young Investigator grant awards by the U.S.-based ... CAMH awards will fund genetic, clinical and neuroimaging studies ... for people with schizophrenia and depression. The ...
... buds on Douglas-fir trees each spring is the result of ... winter, scientists with the U.S. Forest Service,s Pacific Northwest Research ... in the December issue of Science Findings, a monthly publication ... to help managers predict budburst under different scenarios of future ...
... researchers are helping the Pentagon build reliable mind-controlled prosthetic ... rest of their lives. Prosthetic limbs that ... in the laboratory, but there are challenges to making ... obstacles is the neural implants, nearly inevitable failure over ...
Cached Biology News:7 CAMH scientists win Young Investigator awards focused on breakthrough research 27 CAMH scientists win Young Investigator awards focused on breakthrough research 3Winter temperatures play complex role in triggering spring budburst 2University of Houston researchers helping Pentagon build mind-controlled prosthetics 2University of Houston researchers helping Pentagon build mind-controlled prosthetics 3
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... against a partial recombinant FES. ... ~ 250 a.a) partial recombinant protein with ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... AAH35357 OMIM: ...
... raised against a partial recombinant ... PPP4C (NP_002711, 218 a.a. ... protein with GST tag. ... NM_002720 Protein ...
Mouse monoclonal antibody raised against a partial recombinant CAPG. NCBI Entrez Gene ID = CAPG...
Biology Products: