Navigation Links
Roka Bioscience Secures $47.5 Million in Series D Financing
Date:1/6/2012

WARREN, N.J., Jan. 6, 2012 /PRNewswire/ -- Roka Bioscience announced today that it has secured $47.5 million in Series D financing. New investor Aisling Capital participated in the financing along with existing investors OrbiMed Advisors, New Enterprise Associates, Inc., and TPG Biotech. In conjunction with the financing, Josh Bilenker, M.D., Partner at Aisling Capital, will join Roka's Board of Directors. The proceeds of this round will support commercialization of the company's Atlas™ System and ongoing assay development. The company closed on $27.5 million of the Series D round in December 2011 and expects to close on the remaining $20 million later this year. Upon completion of the Series D round, the total amount raised since the company's formation in September 2009 will be $104.7 million.

The Atlas™ System is an innovative fully automated molecular instrument for the detection of food pathogens in food and environmental samples. This instrument utilizes a simple three-step procedure—Enrich, Transfer, Automate—and is capable of processing over 300 samples in 8 hours. The instrument's dynamic scalability and high throughput provides greater efficiency, flexibility, and freedom to meet the ever-increasing demands placed on food safety laboratories. The initial menu for the Atlas System will be the Roka Listeria and Salmonella Detection Assays. Additional assays are currently in development.

"We are very pleased with the continued confidence and support from our existing investors and are excited about adding Aisling Capital, a leading private equity firm, to our investor syndicate," stated Paul Thomas, CEO and President of Roka Bioscience. "The new funding will support our commercialization efforts."

Roka Bioscience

Roka Bioscience is a privately held company focused on developing and commercializing innovative solutions based on molecular technologies for the industrial markets. The company's sc
'/>"/>

SOURCE Roka Bioscience
Copyright©2010 PR Newswire.
All rights reserved

Page: 1 2

Related biology technology :

1. Monogram Biosciences to Present at the Thomas Weisel Partners Healthcare Conference 2008
2. Carna Biosciences Signs Reagent Supply Agreement with Caliper Life Sciences
3. Pressure BioSciences, Inc. to Discuss Second Quarter 2008 Financial Results and Provide Business Update
4. Milestone Biosciences, LLC Further Strengthens Executive Management Team
5. Pressure BioSciences, Inc. Reports Second Quarter 2008 Financial Results and Provides Business Update
6. Access Pharmaceuticals Licenses MuGard to Milestone Biosciences, LLC for North America
7. Pressure BioSciences, Inc. Releases Novel, PCT-dependent Sample Preparation Kit for Systems Biology Studies
8. Neurocrine Biosciences to Present at Thomas Weisel Healthcare Conference and the NewsMakers in the Biotech Industry Conference
9. Start-Up and Emerging Biotech Companies Will Tell Their Stories at Biosciences Showcase Planned for MichBio Expo
10. Protect Marylands Bioscience Industry
11. Ardea Biosciences to Present Data on Lead MEK inhibitor, RDEA119, at EORTC-NCI-AACR Symposium
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:11/24/2014)... Dallas, Texas (PRWEB) November 24, 2014 ... China Adipic Dihydrazide Industry is a professional and ... It provides Adipic Dihydrazide information, like its definition, ... as industry overview. This report covers the international ... as global (such as the US, Europe, Asia, ...
(Date:11/22/2014)... Audubon, PA and London (PRWEB) November 21, 2014 ... in December will explore what comes next for ALS research ... clinical sites. , After the Ice Bucket Challenge: Where ... Merit Cudkowicz, Date: Tuesday, 2 December 2014, Time: ... complimentary , Join expert speaker Dr. Merit Cudkowicz, Julianne ...
(Date:11/22/2014)... 21, 2014 On November 17th Chicago ... 2014 Emerging Medical Technologies Summit in San Francisco to ... Widely regarded among Silicon Valley investors and technology elites ... the win also positions Briteseed to move on ... in 2015 and compete with other elite innovation finalists ...
(Date:11/21/2014)... Quebec , November 21, 2014 ... como responsable comercial   Mariano Rodríguez es ...   KLOX está en marcha para comenzar ... de cura de heridas de reciente aprobación en Europa   ... "la compañía") se complace al anunciar los siguientes nombramientos: ...
Breaking Biology Technology:Adipic Dihydrazide Industry 2019 Research Forecasts on Worldwide, China Regions Now Available at ReportsnReports.com 2Adipic Dihydrazide Industry 2019 Research Forecasts on Worldwide, China Regions Now Available at ReportsnReports.com 3DrugDev Webinars in December to Explore What Comes Next for ALS Research and How We Can Make Life Easier for Clinical Sites 2Insight Product Development Accelerator Member Wins MedTech Innovator Award Competition 2Insight Product Development Accelerator Member Wins MedTech Innovator Award Competition 3KLOX Technologies anuncia sus nombramientos ejecutivos 2KLOX Technologies anuncia sus nombramientos ejecutivos 3KLOX Technologies anuncia sus nombramientos ejecutivos 4KLOX Technologies anuncia sus nombramientos ejecutivos 5
... Laura G. Leff, Department of Biological Sciences, Kent State,University, Kent, Ohio , ... Introduction , Assessing bacterial genetic ... because of difficulties in culturing native bacteria and the large number , ... physiological , traits of most microbes are ...
... and Li Tian, PhD, Bio-Rad Laboratories, 2000 Alfred,Nobel Drive, Hercules, CA 94547 USA, ... The Benchmark Plus microplate reader is a new ... that offers superior convenience, accuracy, and flexibility. , ... , feature has been designed in Microplate ...
, , , , , , back to top...
Cached Biology Technology:Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 2Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 3Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 4Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 5Benchmark Plus Microplate Reader Scan Well Feature 2Benchmark Plus Microplate Reader Scan Well Feature 3
(Date:11/4/2014)... about the way our bodies are assembled during early ... they are supposed to become a nerve or a ... correct place and alignment? Researchers at the University of ... a new study, UM researchers describe the signaling systems ... at the head-trunk region. Their discovery may have important ...
(Date:11/4/2014)... , November 4, 2014   ... market growth   Fuel3D , a developer ... a funding round totaling $6.4 million (£4 million). This funding ... secured earlier this year and paves the way for the ... The funding round was led by Chimera Partners ...
(Date:11/4/2014)... , Nov. 4, 2014   Neurotechnology ... today announced that the latest version of its ... the Ongoing MINEX evaluation organized by ... fingerprint algorithms using the INCITS 378 fingerprint standard ... requirement in public tenders in the ...
Breaking Biology News(10 mins):The inside story: How the brain and skull stay together 2Fuel3D Secures $6.4 Million in Expansion Funding 2Fuel3D Secures $6.4 Million in Expansion Funding 3Neurotechnology Places Second in Ongoing MINEX Ranking for Fingerprint Matching Algorithms 2Neurotechnology Places Second in Ongoing MINEX Ranking for Fingerprint Matching Algorithms 3
... 9, 2009 Even small errors made by cells during protein ... ways to uncover these mistakes and correct them. Though in ... alaninenature has been extra careful, developing not one, but two ... is used correctly. Now, scientists at The Scripps ...
... to celebrate New Year,s Eve, drug industry executives will likely ... companies who make top-selling drugs for heart disease, asthma, and ... of mounting market pressures and a global recession. A timely ... scheduled for the current issue of Chemical & Engineering ...
... The University of Alabama used worms to reel in information ... cellular mechanisms that may be exploited to treat epilepsy. In ... ( http://www.genetics.org ), the researchers explain how the transparent roundworm, ... that control the transport of a molecule (gamma-aminobutyric acid or ...
Cached Biology News:Scripps Research team uncovers chemical basis for extra 'quality control' in protein production 2Scripps Research team uncovers chemical basis for extra 'quality control' in protein production 3Scripps Research team uncovers chemical basis for extra 'quality control' in protein production 4More than fish bait: Worms unlock secrets to new epilepsy treatments 2
... Staining Solution stains proteins in polyacrylamide ... limit >= 8 ng of protein) ... and destaining processes can be performed ... gel (20 min), proteins can be ...
Mouse monoclonal antibody raised against a partial recombinant PASK. NCBI Entrez Gene ID = PASK...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... antibody raised against a partial recombinant FES. ... 120 a.a. ~ 250 a.a) partial recombinant ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Accession Number: AAH35357 ...
Biology Products: