Navigation Links
Professor Nancy Ip Joins aTyr Pharma's Scientific Advisory Board
Date:8/17/2009

SAN DIEGO, Aug. 17 /PRNewswire/ -- aTyr Pharma announced today that Professor Nancy Ip, Chair Professor of the Department of Biochemistry and Director of the Molecular Neuroscience Center at Hong Kong University of Science and Technology (HKUST), has joined their scientific advisory board. An elected academician of the Chinese Academy of Sciences and recipient of China's highest honor in the natural sciences, the National Natural Sciences award, Prof. Ip is widely respected for her discoveries in neurosciences. Her accomplishments include elucidation of key signaling mechanisms for nerve cells that have resulted in the discovery of potential treatments for neurodegenerative disorders such as Alzheimer's and Parkinson's diseases.

aTyr Pharma has discovery candidates for treatment of neurological disorders as well as other indications. These novel, naturally occurring proteins are resectins of tRNA synthetases. According to Jeff Watkins, CEO of aTyr Pharma, "The tRNA synthetases play a fundamental role in protein synthesis, but tRNA synthetases in humans have resected forms ("resectins") which provide additional essential signaling activities. aTyr Pharma has discovered proprietary resectins with neuro-protective activities. Applying Prof. Ip's knowledge and experience in neurosciences will accelerate our understanding and development of aTyr Pharma's novel class of therapeutic proteins, helping us to bring novel treatments for neuronal diseases to the market as quickly as possible."

Professor Paul Schimmel of TSRI and co-founder of aTyr Pharma adds, "Prof. Ip has established a world renowned Center for Molecular Neurosciences at HKUST focused on discovery of new medicines, and we look forward to using her perspectives for understanding the neurobiology of our resectins. In addition to her remarkable discoveries in neuroscience, Prof. Ip brings a passion for promoting science and bio
'/>"/>

SOURCE aTyr Pharma
Copyright©2009 PR Newswire.
All rights reserved

Page: 1 2

Related biology technology :

1. Physics professor lauded for NSF efforts with prestigious award
2. Physics professor lauded for NSF efforts with prestigious award
3. Japanese Cancer Association and Debiopharm Honour Professors Minoru Toyota and Keiichi Nakayama With the 2007 JCA-Mauvernay Award
4. Dr. Thomas Van Dyke Renowned Boston University Professor Joins Imagenetixs Medical Advisory Board
5. Helix Biopharma announces addition of University of Arizona professor Kenneth Hatch as new medical advisor
6. Cambridge Major Appoints Professor John Hartwig as Scientific Advisor
7. Professor Straufs research is Nature Photonics’ cover article
8. Professor Toh-Ming Lu named fellow of the Materials Research Society
9. Professors Marc Feldmann and Sir Ravinder Maini Named Winners of the 2008 Dr. Paul Janssen Award for Biomedical Research
10. Professor-turned-producer learns the movie biz
11. UCF professor develops vaccine to protect against black plague bioterror attack
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:9/19/2014)... YORK, September 18, 2014 Scientists at NYU Langone ... dramatically the efficiency of the process for turning adult ... well-known compounds, including vitamin C. Using the new technique ... cells obtained from adult skin cells by more than ... technique is efficient and reliable, and thus should generally ...
(Date:9/19/2014)... Sept. 19, 2014  Nektar Therapeutics (NASDAQ: ... studies characterizing the analgesic profiles of a series ... receptor agonist molecules. The preclinical research candidates were ... platform. The analgesic properties of kappa ... literature. 1,2 Kappa opioid receptors are expressed ...
(Date:9/19/2014)... -- Dublin ... the addition of the  "Micro Market Monitor : ...      (Logo: http://photos.prnewswire.com/prnh/20130307/600769) , , ,The ... segments in the chromatography market. The market was ... to reach $2.0 billion by 2019, at a ...
(Date:9/18/2014)... -- About POCT POCT, also ... laboratory. It helps in making fast clinical decisions, ... POCT is gaining popularity due to the increasing ... diabetes, heart disease, and obesity. It is generally ... minimize errors during the diagnosis of patients. POCT ...
Breaking Biology Technology:NYU Langone scientists report reliable and highly efficient method for making stem cells 2NYU Langone scientists report reliable and highly efficient method for making stem cells 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 2Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 4Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 5Micro Market Monitor : Global Pre-packed Chromatography Columns 2POCT Market in China 2014-2018 2
... Andrea Armani and Ellis Meng, Both from Viterbi ... at MIT in September , , LOS ... Southern California today announced that two faculty members from the USC ... magazine as some of the world,s top innovators under the ...
... , ... announced that its Oragene®•DNA product has been selected by Prometheus as the sample collection ... for this type of genetic testing service as it solves sample collection challenges inherent ... ...
... PRINCETON, N.J., Aug. 18 Laureate Pharma, Inc., a ... of Joel A. Tune as a new member of its Board ... http://www.newscom.com/cgi-bin/prnh/20080131/N E TH020LOGO ) , ... focused on Laureate,s contract manufacturing business, Mr. Tune brings to Laureate ...
Cached Biology Technology:Two University of Southern California Innovators Recognized by Technology Review's Prestigious TR35 Listing of the World's Top Young Innovators for 2009 2Two University of Southern California Innovators Recognized by Technology Review's Prestigious TR35 Listing of the World's Top Young Innovators for 2009 3Two University of Southern California Innovators Recognized by Technology Review's Prestigious TR35 Listing of the World's Top Young Innovators for 2009 4Two University of Southern California Innovators Recognized by Technology Review's Prestigious TR35 Listing of the World's Top Young Innovators for 2009 5DNA Genotek Sample Collection Kit Selected by Prometheus for MyCeliacID™ Genetic Test 2DNA Genotek Sample Collection Kit Selected by Prometheus for MyCeliacID™ Genetic Test 3Laureate Pharma Elects New Board Member 2
(Date:9/18/2014)... - Washington State University researchers have developed a unique ... power waste cleanup in rural areas. , The ... an inexpensive and quick way to clean up waste ... while reducing pollution. , Professor Haluk Beyenal and ... Engineering and Architecture discuss the system in the online ...
(Date:9/18/2014)... Colo., USA Miranda, a small, icy moon of ... enigmatic bodies in the solar system. Despite its relatively ... of intense resurfacing that resulted in the formation of ... polygonal-shaped regions called coronae. , These coronae are ... at least 200 km across. Arden corona, the largest, ...
(Date:9/18/2014)... University and the Quebec government have discovered microplastics ... Journal of Fisheries and Aquatic Sciences . , ... or industrial cleansers, to which they are commonly ... and buoyancy, they may readily pass through sewage ... in the world,s oceans, but have only recently ...
Breaking Biology News(10 mins):Researchers develop unique waste cleanup for rural areas 2Miranda: An icy moon deformed by tidal heating 2Miranda: An icy moon deformed by tidal heating 3Miranda: An icy moon deformed by tidal heating 4Miranda: An icy moon deformed by tidal heating 5Miranda: An icy moon deformed by tidal heating 6Miranda: An icy moon deformed by tidal heating 7Microplastic pollution discovered in St. Lawrence River sediments 2
... at the University of Minnesota have identified a ... disease begins as a respiratory tract infection, which ... then moves to the lungs, making superantigens (bacterial ... often leading to death due to hypertension and ...
... Outcomes Software (IOS) today,announced the release of ... the award-winning Gene Expression and Proteomics Analysis,Software ... importing and analyzing,protein biomarker data, a high ... we have integrated the Protein Biomarker Package ...
... A novel high-tech microscope will be brought to ... into living organisms. EMBLEM Technology Transfer GmbH (EMBLEM), ... Laboratory (EMBL), announced today that it has signed ... to commercialize a new technology called SPIM (Selective ...
Cached Biology News:U of M researcher examines newly emerging deadly disease 2Improved Outcomes Releases GeneLinker(TM) Gold and Platinum Version 4.6 2Improved Outcomes Releases GeneLinker(TM) Gold and Platinum Version 4.6 3The transparent organism: EMBLEM and Carl Zeiss give labs a unique look at life 2
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
...
... polyclonal antibody raised against a partial recombinant ... (AAH35357, 120 a.a. ~ 250 a.a) partial ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Biology Products: