Navigation Links
PharmSource Introduces Proprietary Resource for Identifying New Business Opportunities in Bio/Pharma
Date:11/24/2008

PharmSource Lead Sheet upgrades database resources to help companies serving biotech/pharma industry to find new business opportunities and market intelligence.

Springfield, VA (PRWEB) November 24, 2008 -- In response to challenging economic times, PharmSource Information Services, Inc. (PharmSource) announces the expansion of its PharmSource Lead Sheet, a weekly web-based service that reports new business opportunities and market intelligence information to companies that serve the biotechnology/pharmaceutical industry.

The newest capability, known as the Qualifying Information Search, enables detailed database searches for biotech/pharma companies world-wide, based on criteria including: company ownership status (public/private), number of employees, annual R&D expenditure amounts, annual revenue amounts, venture capital sources and geographic locations. Search results are delivered via a downloaded spreadsheet. This robust new feature allows users to quickly qualify and manage prospects directly from their desktops, enabling a highly streamlined and effective lead management process.

About the PharmSource Lead Sheet
PharmSource's scientific research team identifies and qualifies new opportunities in the drug development pipeline, including product status changes and bio/pharma alliances and financings. This information signals new opportunities for contract manufacturers and other biotech/pharma vendors. The Lead Sheet electronically delivers up to 70+ new, global business opportunities each week. Available by annual subscription, PharmSource currently offers a complimentary trial of the PharmSource Lead Sheet to qualified companies.

About PharmSource
PharmSource Information Services, Inc. is a respected provider of business intelligence on contract drug development and manufacture. PharmSource assists biotechnology and pharmaceutical companies in implementing
'/>"/>

Source: PRWeb
Copyright©2008 Vocus, Inc.
All rights reserved

Page: 1 2

Related biology technology :

1. Sigma-Aldrich Introduces MISSION(R) In VIVO QUALITY and iScale Oligos(TM) siRNA, a Superior Quality siRNA Designed for RNAi Research in Animal Models
2. Bio-Tec Environmental Introduces Their New Plastic Additive Showing 45% Biodegradation of Plastics in Just 14 Days
3. LI-COR Introduces Three IRDye(R) Near-Infrared Fluorescence Resonance Energy Transfer (NIR-FRET) Protease Substrates
4. Sigma-Aldrich Introduces Methylated DNA Quantification Technology for Epigenetic Research
5. PEAK Surgical Introduces PlasmaBlade(TM) Product Line Extensions for Use in General Surgery
6. Contour Products Introduces Groundbreaking Sleep Apnea, Respiratory and Ergonomic Body Comfort Pillows at Medtrade; Self-Explanatory Products Serve Customer Needs, Expand Retailers DME Offerings
7. Nanoscience Instruments, Inc. Introduces All-Diamond AFM Probes
8. China Biologic Products Enters Into Agreement to Acquire 35% Interest in Xian Huitian Blood Products Co., Ltd. and Introduces Preliminary Guidance for 2009
9. LI-COR Introduces the Odyssey(R) Two-Color NIR Fluorescent Protein Molecular Weight Marker
10. SoluLinK Introduces New One-Shot ChromaLink(TM) Biotin Antibody Labeling Kit with Built-in Biotin Quantification.
11. World Leader in Bench Top Flow Chemistry Instruments ThalesNano, Inc. Introduces an Industry First Seminar Series
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:11/22/2014)... 21, 2014   ... Commercial Officer zu KLOX    ... Chief Financial Officer bestellt    KLOX ... seines jüngst zugelassenen Behandlungssystems zur Wundheilung zu beginnen    ... "Unternehmen") ist sehr erfreut, die folgenden personellen Veränderungen anzukündigen: ...
(Date:11/21/2014)... BELLINGHAM, Washington, USA (PRWEB) November 19, 2014 ... used in our lives was shared with more than ... undergraduate and postgraduate students from the University of Otago ... Outreach Grant . The Otago students, members of the ... Southland New Zealand in early September, giving children from ...
(Date:11/21/2014)... 20, 2014 The California ... research organization representing leading California academic institutions, biotechnology, ... PwC US today released a report revealing ... industry growth. The trend shows a 4 percent ... California Biomedical Industry Report indicates that, while ...
(Date:11/21/2014)... Fayetteville, Arkansas (PRWEB) November 20, 2014 ... partners, Pinnacle Ozone Solutions, LLC (Pinnacle), and PCI, ... equipment, announced that they have been selected to ... City of Fayetteville, Arkansas Paul R. Noland Wastewater ... feature BlueInGreen’s patented HyDOZ® gas dissolution ...
Breaking Biology Technology:KLOX Technologies meldet Neubesetzung von Führungspositionen 2KLOX Technologies meldet Neubesetzung von Führungspositionen 3KLOX Technologies meldet Neubesetzung von Führungspositionen 4KLOX Technologies meldet Neubesetzung von Führungspositionen 5Optics and photonics outreach programs share science, spark fascination with light 2Optics and photonics outreach programs share science, spark fascination with light 3California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 2California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 3California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 4City of Fayetteville Leads Nation with Innovative Ozone Technology 2City of Fayetteville Leads Nation with Innovative Ozone Technology 3City of Fayetteville Leads Nation with Innovative Ozone Technology 4
... veteran, was promoted to president of the General Electric Medical ... who left to become CEO at Invitrogen. The division focuses ... systems . , ,It's a dream job for a corporate ... about $9 billion and produced GE CEO and Chairman Jeffery ...
... develops and sells employee scheduling and management products. The ... and co-founder of Suite Scheduler, a former nurse manager ... employees in a facility. , ,Suite Scheduler products are ... up to 90% of the time to create and ...
... That is, until he gets to the better drugs, faster ... the science behind the Madison-based companys products is likely to ... nears the age when diseases and treatments become as common ... the two and a half-year-old company that Vodenlich joined as ...
Cached Biology Technology:CEO Wilson Defines GE's Health-IT Customer 2CEO Wilson Defines GE's Health-IT Customer 3CEO Wilson Defines GE's Health-IT Customer 4Scheduling made easy with Suite Scheduler 2Scheduling made easy with Suite Scheduler 3Chipping Away at Drug Development 2Chipping Away at Drug Development 3
(Date:11/18/2014)... , Nov. 18, 2014   EyeLock Inc. ... solutions, and MorphoTrust USA (Safran), a ... today announced a strategic partnership to offer comprehensive ... vehicle administration (MVA), airport screening and financial services ... solutions, MorphoTrust serves consumers through a nationwide network ...
(Date:11/11/2014)... , Nov. 11, 2014  Forensicon, Inc., a ... firm, is pleased to announce the promotion of ... Director of Digital Forensics. In Schiff,s new role as ... the team of digital forensics examiners and provide leadership ... Photo - http://photos.prnewswire.com/prnh/20141110/157719 ...
(Date:11/7/2014)... Calif. , Nov. 7, 2014  In conjunction with ... Police Departments, The Community Foundation of the Verdugos ... DNA JUSTICE PROJECT," a $250,000 initiative to keep ... initial phase. In its first six months of existence, the ... needed evidence support for local law enforcement. "Because ...
Breaking Biology News(10 mins):EyeLock, MorphoTrust Form Strategic Partnership to Pursue Commercial Enterprise Deployments 2EyeLock, MorphoTrust Form Strategic Partnership to Pursue Commercial Enterprise Deployments 3Yaniv Schiff Promoted to Director of Digital Forensics at Forensicon, Inc. 2Community Foundation Of The Verdugos Unveils Campaign To Fund Glendale-Burbank DNA Justice Project 2
... February 26, 2013, New York, N.Y. and San Diego, Calif. ... tumor in adults, is challenging to treat because the tumors ... more about the causes of tumor cell growth and drug ... new targeted therapies to potentially treat this deadly cancer. ...
... 2013, Reston, VAResearchers will meet at the Society of ... a number of health concerns that have received growing ... of the presentations, scientists will explore how the development ... related exposures might affect the risk assessment of arsenic ...
... Rockville, Md. The Association for Research in Vision ... three keynote speakers, including two Nobel laureates, during the ... Wash. New this year, the ARVO/Alcon Keynote Series ... Christopher Murray, MD, DPhil. Smithies, of the University ...
Cached Biology News:Novel combination therapy shuts down escape route, killing glioblastoma tumor cells 2Scientists explore topical health issues at meeting in Texas 23 distinguished keynote speakers to present during ARVO 2013 Annual Meeting 2
... a partial recombinant FES. ... 250 a.a) partial recombinant protein with GST ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: BC035357 ... AAH35357 OMIM: 190030, ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
... sufficient materials for 1,464 array sample elements. , , ... , Blocker BSA in PBS (10X): 50 ml ... BupH Phosphate Buffered Saline: 8 packs , 10% ... Pico Luminol Enhancer: 2 x 25 ml , SuperSignal ...
Biology Products: