Navigation Links
Pesticide-Exempt Bed Bug Spray Samples Offered to Northern California Residents as Bed Bugs Remain a Trouble in the Area
Date:4/30/2013

ou would least expect to be infested.”

My Cleaning Products said that bed bugs could be anywhere. So, it warned the public to be careful of them. And to help everybody fight the pests off, it added a bed bug guide on its most-recent news post. It also announced that it would be giving out samples of its pesticide-exempt bed bug spray Bed Bug Bully to help the residents of Northern California and the rest of the public.

In its news post, MCP said that to implement a successful bed bug treatment, one must first learn important things about the pests. And so, it discussed bed bugs' appearance, habits and hiding spots in the said post. Additionally, it detailed how one could implement a prompt, easy, effective and safe bed bug treatment with a bed bug spray.

Of all the bed bug solutions though, the company asserted that the public should opt Bed Bug Bully. It stated that it is effective and safe. It also shared that EPA has classified it as pesticide-exempt under FIFRA 25 (b).

To affirm that it is really the bed bug spray everyone should get, MCP announced that anyone could try a sample of it. It instructed that one just need to go to MyCleaningProducts.com to get a

Source: PRWeb
Copyright©2012 Vocus, Inc.
All rights reserved

Page: 1 2 3

Related biology technology :

1. Pesticide-Exempt Bed Bug Spray Samples Offered by My Cleaning Products to Residents of a Housing Complex Invaded by Bed Bugs
2. Bed Bugs Prompt Fire Departments to Develop New Policy, My Cleaning Products Offers Pesticide-Exempt Bed Bug Spray Samples to Help the Bed-Bug-Affected Fire Stations
3. Vegas Fire Station Battles Bed Bugs, Samples of Pesticide-Exempt Bed Bug Spray Offered by My Cleaning Products to Counter the Critters
4. Pesticide-Exempt Bed Bug Spray Offered to Public After Bed Bugs Troubled a Lincoln Care Facility, My Cleaning Products Relates How to Get One
5. Bed Bug Spray Allegedly Sets House in Flames; My Cleaning Products Suggests Use of the Pesticide-Exempt Bed Bug Bully to Avoid Same Incident
6. Bed Bugs Sneak In to Elementary Schools, My Cleaning Products Advises to Officials and Other Bed Bug Victims Use of Pesticide-Exempt Bed Bug Bully
7. Victims of Pesticide Misuse to Kill Bed Bugs Rise in Numbers; Spray For Bed Bug Says It's Best to Use Pesticide-Exempt Bed Bug Bully Instead
8. Couple Catches Bed Bug in a Hotel, My Cleaning Products Advises Hotel Management to Counter the Pests With Non-Pesticide Bed Bug Spray Bed Bug Bully
9. Cases of Bed Bugs in Hospitals Hike, My Cleaning Products Recommends Non-Pesticide Bed Bug Spray to Counter Bed Bug Outbreak
10. Bed Bugs Hit Another Apartment Complex, My Cleaning Products Says Non-Pesticide Bed Bug Spray Makes the Better Elimination Help and Offers Samples of It
11. Guide How to Kill Spiders Released by My Cleaning Products Together with Its Non-Pesticide Spider Spray
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:11/22/2014)... 21, 2014   ... Commercial Officer zu KLOX    ... Chief Financial Officer bestellt    KLOX ... seines jüngst zugelassenen Behandlungssystems zur Wundheilung zu beginnen    ... "Unternehmen") ist sehr erfreut, die folgenden personellen Veränderungen anzukündigen: ...
(Date:11/21/2014)... BELLINGHAM, Washington, USA (PRWEB) November 19, 2014 ... used in our lives was shared with more than ... undergraduate and postgraduate students from the University of Otago ... Outreach Grant . The Otago students, members of the ... Southland New Zealand in early September, giving children from ...
(Date:11/21/2014)... 20, 2014 The California ... research organization representing leading California academic institutions, biotechnology, ... PwC US today released a report revealing ... industry growth. The trend shows a 4 percent ... California Biomedical Industry Report indicates that, while ...
(Date:11/21/2014)... Fayetteville, Arkansas (PRWEB) November 20, 2014 ... partners, Pinnacle Ozone Solutions, LLC (Pinnacle), and PCI, ... equipment, announced that they have been selected to ... City of Fayetteville, Arkansas Paul R. Noland Wastewater ... feature BlueInGreen’s patented HyDOZ® gas dissolution ...
Breaking Biology Technology:KLOX Technologies meldet Neubesetzung von Führungspositionen 2KLOX Technologies meldet Neubesetzung von Führungspositionen 3KLOX Technologies meldet Neubesetzung von Führungspositionen 4KLOX Technologies meldet Neubesetzung von Führungspositionen 5Optics and photonics outreach programs share science, spark fascination with light 2Optics and photonics outreach programs share science, spark fascination with light 3California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 2California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 3California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 4City of Fayetteville Leads Nation with Innovative Ozone Technology 2City of Fayetteville Leads Nation with Innovative Ozone Technology 3City of Fayetteville Leads Nation with Innovative Ozone Technology 4
... veteran, was promoted to president of the General Electric Medical ... who left to become CEO at Invitrogen. The division focuses ... systems . , ,It's a dream job for a corporate ... about $9 billion and produced GE CEO and Chairman Jeffery ...
... develops and sells employee scheduling and management products. The ... and co-founder of Suite Scheduler, a former nurse manager ... employees in a facility. , ,Suite Scheduler products are ... up to 90% of the time to create and ...
... That is, until he gets to the better drugs, faster ... the science behind the Madison-based companys products is likely to ... nears the age when diseases and treatments become as common ... the two and a half-year-old company that Vodenlich joined as ...
Cached Biology Technology:CEO Wilson Defines GE's Health-IT Customer 2CEO Wilson Defines GE's Health-IT Customer 3CEO Wilson Defines GE's Health-IT Customer 4Scheduling made easy with Suite Scheduler 2Scheduling made easy with Suite Scheduler 3Chipping Away at Drug Development 2Chipping Away at Drug Development 3
(Date:11/18/2014)... , Nov. 18, 2014   EyeLock Inc. ... solutions, and MorphoTrust USA (Safran), a ... today announced a strategic partnership to offer comprehensive ... vehicle administration (MVA), airport screening and financial services ... solutions, MorphoTrust serves consumers through a nationwide network ...
(Date:11/11/2014)... , Nov. 11, 2014  Forensicon, Inc., a ... firm, is pleased to announce the promotion of ... Director of Digital Forensics. In Schiff,s new role as ... the team of digital forensics examiners and provide leadership ... Photo - http://photos.prnewswire.com/prnh/20141110/157719 ...
(Date:11/7/2014)... Calif. , Nov. 7, 2014  In conjunction with ... Police Departments, The Community Foundation of the Verdugos ... DNA JUSTICE PROJECT," a $250,000 initiative to keep ... initial phase. In its first six months of existence, the ... needed evidence support for local law enforcement. "Because ...
Breaking Biology News(10 mins):EyeLock, MorphoTrust Form Strategic Partnership to Pursue Commercial Enterprise Deployments 2EyeLock, MorphoTrust Form Strategic Partnership to Pursue Commercial Enterprise Deployments 3Yaniv Schiff Promoted to Director of Digital Forensics at Forensicon, Inc. 2Community Foundation Of The Verdugos Unveils Campaign To Fund Glendale-Burbank DNA Justice Project 2
... February 26, 2013, New York, N.Y. and San Diego, Calif. ... tumor in adults, is challenging to treat because the tumors ... more about the causes of tumor cell growth and drug ... new targeted therapies to potentially treat this deadly cancer. ...
... 2013, Reston, VAResearchers will meet at the Society of ... a number of health concerns that have received growing ... of the presentations, scientists will explore how the development ... related exposures might affect the risk assessment of arsenic ...
... Rockville, Md. The Association for Research in Vision ... three keynote speakers, including two Nobel laureates, during the ... Wash. New this year, the ARVO/Alcon Keynote Series ... Christopher Murray, MD, DPhil. Smithies, of the University ...
Cached Biology News:Novel combination therapy shuts down escape route, killing glioblastoma tumor cells 2Scientists explore topical health issues at meeting in Texas 23 distinguished keynote speakers to present during ARVO 2013 Annual Meeting 2
... a partial recombinant FES. ... 250 a.a) partial recombinant protein with GST ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: BC035357 ... AAH35357 OMIM: 190030, ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
... sufficient materials for 1,464 array sample elements. , , ... , Blocker BSA in PBS (10X): 50 ml ... BupH Phosphate Buffered Saline: 8 packs , 10% ... Pico Luminol Enhancer: 2 x 25 ml , SuperSignal ...
Biology Products: