Navigation Links
Occupational Health Brings Record Crowds to AOHP National Conference in Las Vegas
Date:11/2/2012

DENVER, Nov. 2, 2012 /PRNewswire/ -- Even Elvis attended the annual AOHP Conference at Caesar Palace in Vegas. "Attendance was up, with the highest registration in years," reported Annie Wiest, AOHP account manager and conference planner.

(Logo: http://photos.prnewswire.com/prnh/20120209/LA50271LOGO)

A controversy on mandating Influenza vaccinations for healthcare workers brought hundreds to an expert panel, moderated by Axion Health's Chief Medical Information Officer, Dr. Lee Newman.  Recognized globally as a health expert and Professor of Public Health, Dr. Newman also spoke on current research practices and risk of hazardous chemicals.

Recently, infectious disease outbreaks have spurred concern, reviving memories of when diseases such as Influenza and Tuberculosis killed hundreds of thousands.  The CDC states "the re-emergence of TB and an overall increase in infectious disease mortality during the 1980s and early 1990s provide additional evidence that as long as microbes can evolve, new diseases will appear." Also immigration from countries having higher TB rates increases current risks in the US.

Axion Healthcare Research Analyst, Jennifer Guida, MPH co-presented a session on the science and economics of diagnostic tests for TB. Ms Guida noted that the statistics behind diagnostic tests are important for making clinical decisions during medical surveillance programs.

"Modern techniques of testing, electronic recording and distribution of results have led to increased understanding and control of infectious outbreaks," noted Thomas Carson, CEO Axion Health. "I'm pleased the use of Internet-based systems like ReadySet can he
'/>"/>

SOURCE Axion Health
Copyright©2012 PR Newswire.
All rights reserved

Page: 1 2

Related biology technology :

1. HealthTech Capital Announces Awards for the HealthTech Conference 2012 - Building a Business in the New HealthTech Ecosystem
2. Global Mobile Health Application Market 2011-2015 : MarketResearchReports.Biz
3. QIAGEN and Bayer HealthCare Partner to Develop Companion Diagnostics to Guide Treatment Decisions for Targeted Cancer Therapies
4. AspenBio to Present at 2012 Aegis Healthcare Conference
5. Anlit to Present Oral Health Supplement for Children at CPhI Worldwide
6. Genomic Health Announces Positive Topline Results of Large Prostate Cancer Clinical Validation Study; Company to Proceed with 2013 Commercial Launch
7. Epigenetics Holds Key to Healthier Future
8. Ohio State Hosting International Personalized Health Care Leaders
9. Neuralstem President And CEO To Present At The 2012 Rodman & Renshaw Annual Healthcare Conference
10. Lexicon Pharmaceuticals To Present At The Morgan Stanley Global Healthcare Conference
11. Center will create self-powered health monitoring devices
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:9/19/2014)... YORK, September 18, 2014 Scientists at NYU Langone ... dramatically the efficiency of the process for turning adult ... well-known compounds, including vitamin C. Using the new technique ... cells obtained from adult skin cells by more than ... technique is efficient and reliable, and thus should generally ...
(Date:9/19/2014)... Sept. 19, 2014  Nektar Therapeutics (NASDAQ: ... studies characterizing the analgesic profiles of a series ... receptor agonist molecules. The preclinical research candidates were ... platform. The analgesic properties of kappa ... literature. 1,2 Kappa opioid receptors are expressed ...
(Date:9/19/2014)... -- Dublin ... the addition of the  "Micro Market Monitor : ...      (Logo: http://photos.prnewswire.com/prnh/20130307/600769) , , ,The ... segments in the chromatography market. The market was ... to reach $2.0 billion by 2019, at a ...
(Date:9/18/2014)... -- About POCT POCT, also ... laboratory. It helps in making fast clinical decisions, ... POCT is gaining popularity due to the increasing ... diabetes, heart disease, and obesity. It is generally ... minimize errors during the diagnosis of patients. POCT ...
Breaking Biology Technology:NYU Langone scientists report reliable and highly efficient method for making stem cells 2NYU Langone scientists report reliable and highly efficient method for making stem cells 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 2Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 4Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 5Micro Market Monitor : Global Pre-packed Chromatography Columns 2POCT Market in China 2014-2018 2
... , ... computational drug discovery solutions provider, announced today they have licensed ... Drug Administration,s National Center for Toxicological Research (NCTR). , Under ... access to the complete TIP structural knowledgebase via ...
... , NEW ORLEANS, Dec. 8 HemaQuest Pharmaceuticals presented data ... of its lead drug candidate, HQK-1001, in sickle cell disease ... Society of Hematology in New Orleans. The preclinical studies ... of therapeutic agents that have been used in the past ...
... ... Extended Wear Hearing Aid. , ... Newark, CA (PRWEB) December 8, 2009 -- Whether it’s a crackling fire, jingling sleigh bells, ... miss out on the joyous sounds of the holidays. Lyric, the first 100% invisible ...
Cached Biology Technology:Eidogen-Sertanty Licenses TIP to the FDA 2HemaQuest Pharmaceuticals Presents Promising Results in Sickle Cell Disease and Beta Thalassemia 2HemaQuest Pharmaceuticals Presents Promising Results in Sickle Cell Disease and Beta Thalassemia 3Lyric Presents the Sounds of the Season 2
(Date:9/18/2014)... and their colleagues have built the first smartphone ... performance and behavioral trends. In other words, your ... if you don,t -- and how that affects ... happiness, stress, depression and loneliness to their academic ... population for example, to monitor mental health, ...
(Date:9/18/2014)... celebrated tonight at the third annual Golden Goose Award ... premature infants and in paving the way for the ... supported by the National Science Foundation, the National Institutes ... be honored at a ceremony at the Library of ... of Congress will be on hand to help present ...
(Date:9/18/2014)... when people are too stressed they are often grouchy, ... Mind Institute (BMI) at EPFL have just highlighted a ... stress and the loss of social skills and cognitive ... synaptic regulatory molecule in the brain. This was revealed ... , Carmen Sandi,s team went to look for ...
Breaking Biology News(10 mins):New Dartmouth smartphone app reveals users' mental health, performance, behavior 2New Dartmouth smartphone app reveals users' mental health, performance, behavior 3New Dartmouth smartphone app reveals users' mental health, performance, behavior 43rd annual Golden Goose award ceremony honors 8 researchers; Unusual work had big results 2How stress tears us apart 2
... DNA is copied into ribonucleic acid (RNA) molecules, also ... making proteins, and a collection of all the transcripts ... Jaiswal, Assistant Professor of Botany and Plant Pathology at ... Jaiswal,s laboratory, and colleagues assembled transcriptomes of a noxious ...
... AMHERST, Mass. Biochemists at the University of Massachusetts ... insight into how protein synthesis and degradation help to ... they reveal how two proteins shelter each other in ... and safely. Cells must routinely dispose of leftover ...
... University of Florida paleontologists have discovered remarkably well-preserved fossils ... science during recent Panama Canal excavations that began in ... and an extinct hippo-like species inhabited Central America during ... expands the range of ancient animals in the subtropics ...
Cached Biology News:Assembling the transcriptome of a noxious weed: New resources for studying how plants invade 2New insight into double-protected dance of cell division 2UF scientists discover new crocodilian, hippo-like species from Panama 2UF scientists discover new crocodilian, hippo-like species from Panama 3
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
...
... polyclonal antibody raised against a partial recombinant ... (AAH35357, 120 a.a. ~ 250 a.a) partial ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Biology Products: