Navigation Links
Nano bundles pack a powerful punch
Date:8/22/2011

and Nolan Nicholas, now a researcher at Matric.

The array was then transferred to a copper electrode with thin layers of gold and titanium to aid adhesion and electrical stability. The nanotube bundles (the primary electrodes) were doped with sulfuric acid to enhance their conductive properties; then they were covered with thin coats of aluminum oxide (the dielectric layer) and aluminum-doped zinc oxide (the counterelectrode) through a process called atomic layer deposition (ALD). A top electrode of silver paint completed the circuit.

"Essentially, you get this metal/insulator/metal structure," said Pint. "No one's ever done this with such a high-aspect-ratio material and utilizing a process like ALD."

Hauge said the new supercapacitor is stable and scaleable. "All solid-state solutions to energy storage will be intimately integrated into many future devices, including flexible displays, bio-implants, many types of sensors and all electronic applications that benefit from fast charge and discharge rates," he said.

Pint said the supercapacitor holds a charge under high-frequency cycling and can be naturally integrated into materials. He envisioned an electric car body that is a battery, or a microrobot with an onboard, nontoxic power supply that can be injected for therapeutic purposes into a patient's bloodstream.

Pint said it would be ideal for use under the kind of extreme conditions experienced by desert-based solar cells or in satellites, where weight is also a critical factor. "The challenge for the future of energy systems is to integrate things more efficiently. This solid-state architecture is at the cutting edge," he said.


'/>"/>

Contact: David Ruth
druth@rice.edu
713-348-6327
Rice University
Source:Eurekalert

Page: 1 2

Related biology technology :

1. Indianas $44 Billion Life Sciences Industry Packs a Powerful Punch
2. Powerful new way to control magnetism
3. DNA2.0 Introduces Powerful, Free Gene Design Software
4. Unigen Announces the Launch of Nivitol™ - Powerful New Anti-Aging Skin Care Ingredient
5. Mettler Toledo and PDS Pathology Data Systems Integrate Powerful Solutions for Faster and More Accurate Preclinical Studies
6. New silicon-germanium nanowires could lead to smaller, more powerful electronic devices
7. Elsevier is Re-Launching "Embase" to be a Powerful Resource Providing Deep Insights and Answers to Biomedical Researchers
8. Powerful Image Registration and Recognition Software Unveiled for Medical, Satellite, and Defense Imaging Industries
9. Nanotechnologists gain powerful new materials probe
10. Denser, more powerful computer chips possible with plasmonic lenses that fly
11. Aureus Pharma Releases AurPROFILER(R) - a New and Powerful Pharmacology Profiling Solution
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:9/19/2014)... YORK, September 18, 2014 Scientists at NYU Langone ... dramatically the efficiency of the process for turning adult ... well-known compounds, including vitamin C. Using the new technique ... cells obtained from adult skin cells by more than ... technique is efficient and reliable, and thus should generally ...
(Date:9/19/2014)... Sept. 19, 2014  Nektar Therapeutics (NASDAQ: ... studies characterizing the analgesic profiles of a series ... receptor agonist molecules. The preclinical research candidates were ... platform. The analgesic properties of kappa ... literature. 1,2 Kappa opioid receptors are expressed ...
(Date:9/19/2014)... -- Dublin ... the addition of the  "Micro Market Monitor : ...      (Logo: http://photos.prnewswire.com/prnh/20130307/600769) , , ,The ... segments in the chromatography market. The market was ... to reach $2.0 billion by 2019, at a ...
(Date:9/18/2014)... -- About POCT POCT, also ... laboratory. It helps in making fast clinical decisions, ... POCT is gaining popularity due to the increasing ... diabetes, heart disease, and obesity. It is generally ... minimize errors during the diagnosis of patients. POCT ...
Breaking Biology Technology:NYU Langone scientists report reliable and highly efficient method for making stem cells 2NYU Langone scientists report reliable and highly efficient method for making stem cells 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 2Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 4Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 5Micro Market Monitor : Global Pre-packed Chromatography Columns 2POCT Market in China 2014-2018 2
... , ... computational drug discovery solutions provider, announced today they have licensed ... Drug Administration,s National Center for Toxicological Research (NCTR). , Under ... access to the complete TIP structural knowledgebase via ...
... , NEW ORLEANS, Dec. 8 HemaQuest Pharmaceuticals presented data ... of its lead drug candidate, HQK-1001, in sickle cell disease ... Society of Hematology in New Orleans. The preclinical studies ... of therapeutic agents that have been used in the past ...
... ... Extended Wear Hearing Aid. , ... Newark, CA (PRWEB) December 8, 2009 -- Whether it’s a crackling fire, jingling sleigh bells, ... miss out on the joyous sounds of the holidays. Lyric, the first 100% invisible ...
Cached Biology Technology:Eidogen-Sertanty Licenses TIP to the FDA 2HemaQuest Pharmaceuticals Presents Promising Results in Sickle Cell Disease and Beta Thalassemia 2HemaQuest Pharmaceuticals Presents Promising Results in Sickle Cell Disease and Beta Thalassemia 3Lyric Presents the Sounds of the Season 2
(Date:9/18/2014)... and their colleagues have built the first smartphone ... performance and behavioral trends. In other words, your ... if you don,t -- and how that affects ... happiness, stress, depression and loneliness to their academic ... population for example, to monitor mental health, ...
(Date:9/18/2014)... celebrated tonight at the third annual Golden Goose Award ... premature infants and in paving the way for the ... supported by the National Science Foundation, the National Institutes ... be honored at a ceremony at the Library of ... of Congress will be on hand to help present ...
(Date:9/18/2014)... when people are too stressed they are often grouchy, ... Mind Institute (BMI) at EPFL have just highlighted a ... stress and the loss of social skills and cognitive ... synaptic regulatory molecule in the brain. This was revealed ... , Carmen Sandi,s team went to look for ...
Breaking Biology News(10 mins):New Dartmouth smartphone app reveals users' mental health, performance, behavior 2New Dartmouth smartphone app reveals users' mental health, performance, behavior 3New Dartmouth smartphone app reveals users' mental health, performance, behavior 43rd annual Golden Goose award ceremony honors 8 researchers; Unusual work had big results 2How stress tears us apart 2
... DNA is copied into ribonucleic acid (RNA) molecules, also ... making proteins, and a collection of all the transcripts ... Jaiswal, Assistant Professor of Botany and Plant Pathology at ... Jaiswal,s laboratory, and colleagues assembled transcriptomes of a noxious ...
... AMHERST, Mass. Biochemists at the University of Massachusetts ... insight into how protein synthesis and degradation help to ... they reveal how two proteins shelter each other in ... and safely. Cells must routinely dispose of leftover ...
... University of Florida paleontologists have discovered remarkably well-preserved fossils ... science during recent Panama Canal excavations that began in ... and an extinct hippo-like species inhabited Central America during ... expands the range of ancient animals in the subtropics ...
Cached Biology News:Assembling the transcriptome of a noxious weed: New resources for studying how plants invade 2New insight into double-protected dance of cell division 2UF scientists discover new crocodilian, hippo-like species from Panama 2UF scientists discover new crocodilian, hippo-like species from Panama 3
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
...
... polyclonal antibody raised against a partial recombinant ... (AAH35357, 120 a.a. ~ 250 a.a) partial ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Biology Products: