Navigation Links
NW Bio 2012 Annual Report Shows Strong Progress And Enhancement Of Leadership Position
Date:4/8/2013

ior manager from big pharma, who has taken blockbuster drugs through development and into commercialization;
  • expansion of the Company's Board with experts in the biotech/pharma sector and in manufacturing; and
  • issuance of a dozen new patents in the Company's worldwide patent portfolio.
  • The Company's cash expenditures of $22.8 million for all of these operations in 2012 were substantially below the level of expenditures usually seen with companies that are in large Phase III clinical trials, and/or that have multiple product development programs under way, especially with operations on two continents.

    The Company's progress has continued to accelerate in 2013.  It differentiates NW Bio as a leader in immune therapies for cancer in multiple ways, including the following:

  • having 3 distinct product lines, with 2 products at the Phase III stage, and the 3rd product in the process of entering an unusually broad combined Phase I/II trial;
  • having 2 products that are each expected to be applicable to all solid tumor cancers (one for cases with tumors that are surgically removed and the other for inoperable tumors);
  • having manufacturing processes for 2 products that have been accepted by regulators for clinical trials at the Phase III level (which processes must be the same as will be used for commercialization) – a significant milestone, especially for cell therapy products;
  • having operations (both clinical and manufacturing) established in both the US and Europe, the 2 largest medical markets in the world;
  • having over 180 issued and pending patents worldwide;
  • having numerous chances to win in the near term, with 3 parallel product programs with ongoing value milestones;
  • having extensive external validations, through regulatory decisions from highly respected regulators in 3 countries (US, UK and Germany), and multiple large marquee partners. '/>"/>

  • SOURCE Northwest Biotherapeutics
    Copyright©2012 PR Newswire.
    All rights reserved

    Page: 1 2 3 4 5 6 7 8 9 10 11

    Related biology technology :

    1. DIA 2013 49th Annual Meeting to Address Hot Topics Surrounding Patient Therapies
    2. Rosetta Genomics Announces Poster Presentations at AACR Annual Meeting 2013
    3. Susan Cain Will Kick Off 2013 ASAE Annual Meeting & Exposition, Dan Heath is Closing General Session Speaker
    4. Electronic Headband That Detects and Treats Addictive In-Sleep Behavior to be Demonstrated at Annual Holistic Dental Conference by Holistic Technologies
    5. Professional Pricing Society Explores New Role of Pricers as Change Agents and Leaders at 24th Annual Spring Conference
    6. Upsher-Smith Presents Favorable Phase I Data For USL261, A Novel Formulation Of Intranasal Midazolam, At 65th Annual Meeting Of The American Academy Of Neurology
    7. NW Bio To Review Its Leadership Position In Immune Therapy At The 25th Annual Roth Conference
    8. Smith & Nephew hosts thought-leading surgeons, showcases new technology at American Academy of Orthopaedic Surgeons annual meeting
    9. Archimedes Inc. Renews Annual Marketing Agreement with HealthEconomics.Com
    10. Palatin Technologies To Present At The 25th Annual ROTH Conference
    11. Keryx Biopharmaceuticals to Present at the 25th Annual ROTH Conference
    Post Your Comments:
    *Name:
    *Comment:
    *Email:
    (Date:12/19/2014)... Dec. 18, 2014 Egenix, Inc. is pleased to ... Chairman of the Board, to succeed Donald Fresne ; ... will continue as a member of the Board.  In recognition ... to the company over almost twenty years, the Board designated ... of Directors has established a Search Committee to find a ...
    (Date:12/17/2014)... 2014 The Activated Carbon Manufacturing ... is why IBISWorld updated its original industry research report. ... from an intensified focus on environmental policy. Over the ... standards for power plants and a range of other ... Industry Analyst Sarah Kahn, “a range of downstream industrial ...
    (Date:12/17/2014)... 17, 2014 Achim Noack has been ... Stoller Group. In this position, Noack will assist Jerry ... matters, develop marketing strategy and supervise global marketing management ... “Achim has tremendous knowledge and experience in the crop ... “His experience and innovative thinking will be a great ...
    (Date:12/17/2014)... Dallas, Texas (PRWEB) December 17, 2014 ... research on Global Quartz Tubing industry. For an ... information, definition, classification, application, industry chain structure, industry ... domestic quartz tubing industry has witnessed ... through a number of acquisitions. This report mentions ...
    Breaking Biology Technology:Activated Carbon Manufacturing in the US Industry Market Research Report Has Been Updated from IBISWorld 2Activated Carbon Manufacturing in the US Industry Market Research Report Has Been Updated from IBISWorld 3Achim Noack Joins Stoller Group as Global Vice President of Marketing and Administration 22020 Quartz Tubing Market: Global Development & Forecasts Analysis Now at DeepResearchReports.com 2
    ... BioMed Realty Trust, Inc. (NYSE: BMR ), a real ... Science Industry®, today announced financial results for the third quarter ended ... Generated record total revenues for the third quarter of ... in 2009. Increased rental revenues for the third quarter by ...
    ... to develop relatively advanced tools after their brains evolved a ... that investigates why it took early humans almost two million ... axe. Researchers used computer modelling and tiny sensors embedded ... humans needed in order to make two types of tools ...
    ... New Mexico, NOVEMBER 3, 2010Scientists at the U.S. Department ... Laboratory have fabricated transparent thin films capable of absorbing ... area. The material, described in the journal Chemistry ... transparent solar panels. "Potentially, with future refinement of ...
    Cached Biology Technology:BioMed Realty Trust Reports Third Quarter 2010 Financial Results 2BioMed Realty Trust Reports Third Quarter 2010 Financial Results 3BioMed Realty Trust Reports Third Quarter 2010 Financial Results 4BioMed Realty Trust Reports Third Quarter 2010 Financial Results 5BioMed Realty Trust Reports Third Quarter 2010 Financial Results 6BioMed Realty Trust Reports Third Quarter 2010 Financial Results 7BioMed Realty Trust Reports Third Quarter 2010 Financial Results 8BioMed Realty Trust Reports Third Quarter 2010 Financial Results 9BioMed Realty Trust Reports Third Quarter 2010 Financial Results 10BioMed Realty Trust Reports Third Quarter 2010 Financial Results 11BioMed Realty Trust Reports Third Quarter 2010 Financial Results 12BioMed Realty Trust Reports Third Quarter 2010 Financial Results 13BioMed Realty Trust Reports Third Quarter 2010 Financial Results 14BioMed Realty Trust Reports Third Quarter 2010 Financial Results 15BioMed Realty Trust Reports Third Quarter 2010 Financial Results 16BioMed Realty Trust Reports Third Quarter 2010 Financial Results 17Stone Age humans needed more brain power to make big leap in tool design 2Scientists produce transparent, light-harvesting material 2
    (Date:12/11/2014)... 2014  Data Sciences International (DSI), the global ... new series of digital telemetry implants to meet ... series, part of the PhysioTel™ Digital platform, was ... physiologic data when incorporating functional endpoints into repeat-dose ... toxicology studies has evolved from short ECG strips ...
    (Date:12/10/2014)... DIEGO , Dec. 9, 2014 CIE ... collaboration catalyst that provides the connective tissue that enhances ... enabling them to easily share client-level information; earned a ... to expand to organizations serving seniors aging in community ... Diego" partner on December 11 th 4-6p. ...
    (Date:12/5/2014)... , Dec. 4, 2014  Tute Genomics, a leader ... million in Series A1 funding led by UK-based Eurovestech. ... participated in the investment round. "We are ... community adopts next-generation sequencing and seeks new approaches for ... Reid Robison , MD MBA, and CEO of Tute ...
    Breaking Biology News(10 mins):New telemetry implants expected to change how large animal toxicology studies are conducted 2Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 2Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 3Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 4Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 2Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 3
    ... You don,t need to spray weedkiller to remove the ... with either boiling water, steam or flaming will dispatch even ... a new PhD project from the University of Copenhagen. ... is important that each treatment is dosed correctly. Basically, ...
    ... Johns Hopkins scientists have engineered cells that behave like ... on one or more unique inputs. This feat, published in ... eventually help researchers create computers that use cells as tiny ... in the Department of Cell Biology and member of the ...
    ... BETHESDA, MD May 30, 2012 The Genetics Society ... six graduate students and seven postdoctoral researchers as recipients of ... Each of these early-career geneticists receives a $1,000 travel award ... in a laboratory course of their choice that will enhance ...
    Cached Biology News:Blanch your weeds 2Training cells to perform Boolean functions? It's logical 2Training cells to perform Boolean functions? It's logical 3The Genetics Society of America announces DeLill Nasser Travel Award recipients 2
    ... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
    Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
    Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
    ... kit contains sufficient materials for 1,464 array sample elements. ... 4 each , Blocker BSA in PBS (10X): ... , BupH Phosphate Buffered Saline: 8 packs ... SuperSignal West Pico Luminol Enhancer: 2 x 25 ml ...
    Biology Products: