Navigation Links
NSG Has Just Released Its NIST 930e Photometric Accuracy Standard Kit for Spectrometer Calibration and It's Changing the Spectroscopy World
Date:7/18/2013

Farmingdale, NY (PRWEB) July 18, 2013

NSG Precision Cells is the home of the world's only NIST 930e UV/VIS Calibration Standards that never need recalibration due to material aging. For years, NSG has specialized in providing quality cuvettes, cells and microfluidic chips to help researchers get their work done more efficiently, comfortably and safely. NSG offers unique, high-grade NIST 930e replacement calibration kits manufactured with the precision that its customers have come to rely upon. NSG's product line includes a wide range of accessories including UV/VIS calibration standards, a fully complete UV cuvette line for spectrophotometers and fluorometers, plastic disposable cuvettes, micro cells, cell washers, and much more. NSG's catalog offering represents the most popular types and sizes of cuvettes according to the requirements of our customers.

The revolution is on with NSG’s NIST 930e replacement kit. This kit is an ideal replacement for the NIST 930e VIS photometric accuracy kit, which contains a 10%T, 20%T and 30%T filter set. The operational wavelength of this set enables a user to calibrate for photometric accuracy in the range of 400-700nm and save thousands of dollars in filters and calibration fees. Just one of the HF filters can do the job of several of NSG's competitors’ filters. If this weren’t enough, unlike all of our competitors, NSG’s solid-state NIST 930e calibration standards are the only on the market that never need
'/>"/>

Source: PRWeb
Copyright©2012 Vocus, Inc.
All rights reserved

Page: 1 2

Related biology technology :

1. Guide How to Kill Spiders Released by My Cleaning Products Together with Its Non-Pesticide Spider Spray
2. InstantGMP-Lite(TM) Electronic Batch Record Software Version 2.0 Just Released
3. KiwiViewer 2.0 Released and Available for Download in iTunes
4. In-Depth Black Mold Removal Guide Released by My Cleaning Products, Company Offers Complimentary Sample of Molderizer and Safe Shield Along With It
5. How To Get Rid of Bed Bugs Complete Extermination Guidelines Released By My Cleaning Products, Company Announces It's Also Giving Out Samples of Its Bed Bug Spray
6. Unusual Method on How to Get Rid of Bed Bugs Without Pesticides Has Been Released To The Public, MyCleaningProducts.com Explains
7. Non-Intrusive Black Mold Removal Procedure Released By Former Mold Remediation Specialist, MyCleaningProducts.com Explains
8. As Released on 30 December, 2011: Novogen Modifies ADR Program and Makes Further Investment Into Marshall Edwards
9. ICD-10 Coding Knowledge Assessment Tool Released
10. Quantum Resonance Calibration Standards for Photometric Accuracy Replacing Old Fashioned Liquid Reference Standards
11. AfricanAncestry.com Rolls Out Improved MyDNAMix Admixture Test for People of all Races; Enhancements Increase Accuracy in Estimation of Ancestral Makeup
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:12/19/2014)... BioPlus Specialty Pharmacy ... has an expanded team of Regional Pharmaceutical Care ... prescriber offices in their regions, with specific areas ... a variety of Regional Pharmaceutical Care Liaisons specializing ... hepatitis C help prescribers understand all the new ...
(Date:12/19/2014)... ME (PRWEB) December 18, 2014 Ed ... director of the Center for Excellence in the Neurosciences ... New England, has been selected as a member of ... is the first neuroscientist from Maine to receive this ... nonprofit organization supported entirely by the Dana Foundation. ...
(Date:12/19/2014)... 2014 In contrast to traditional LED ... various colors, Valoya uses proprietary LED technology to incorporate ... possible uniformity which is critical in low proximity installations. ... accuracy throughout its lifetime which is up to four ... , "The investment cost was clearly higher when compared ...
(Date:12/19/2014)... Mass. , Dec. 18, 2014  Decision Resources ... dental biomaterial market will grow moderately through 2023 ... procedures and growing awareness of dental biomaterials all spur ... markets such as China and ... will bring dental procedures within reach for a larger ...
Breaking Biology Technology:BioPlus Specialty Pharmacy Expands ‘Regional Pharmaceutical Care Liaison’ Team 2BioPlus Specialty Pharmacy Expands ‘Regional Pharmaceutical Care Liaison’ Team 3UNE's Ed Bilsky Named Member of Dana Alliance for Brain Initiatives 2UNE's Ed Bilsky Named Member of Dana Alliance for Brain Initiatives 3Asia Pacific Dental Biomaterial Market Will Grow Strongly Through 2023 2Asia Pacific Dental Biomaterial Market Will Grow Strongly Through 2023 3
... BioMed Realty Trust, Inc. (NYSE: BMR ), a real ... Science Industry®, today announced financial results for the third quarter ended ... Generated record total revenues for the third quarter of ... in 2009. Increased rental revenues for the third quarter by ...
... to develop relatively advanced tools after their brains evolved a ... that investigates why it took early humans almost two million ... axe. Researchers used computer modelling and tiny sensors embedded ... humans needed in order to make two types of tools ...
... New Mexico, NOVEMBER 3, 2010Scientists at the U.S. Department ... Laboratory have fabricated transparent thin films capable of absorbing ... area. The material, described in the journal Chemistry ... transparent solar panels. "Potentially, with future refinement of ...
Cached Biology Technology:BioMed Realty Trust Reports Third Quarter 2010 Financial Results 2BioMed Realty Trust Reports Third Quarter 2010 Financial Results 3BioMed Realty Trust Reports Third Quarter 2010 Financial Results 4BioMed Realty Trust Reports Third Quarter 2010 Financial Results 5BioMed Realty Trust Reports Third Quarter 2010 Financial Results 6BioMed Realty Trust Reports Third Quarter 2010 Financial Results 7BioMed Realty Trust Reports Third Quarter 2010 Financial Results 8BioMed Realty Trust Reports Third Quarter 2010 Financial Results 9BioMed Realty Trust Reports Third Quarter 2010 Financial Results 10BioMed Realty Trust Reports Third Quarter 2010 Financial Results 11BioMed Realty Trust Reports Third Quarter 2010 Financial Results 12BioMed Realty Trust Reports Third Quarter 2010 Financial Results 13BioMed Realty Trust Reports Third Quarter 2010 Financial Results 14BioMed Realty Trust Reports Third Quarter 2010 Financial Results 15BioMed Realty Trust Reports Third Quarter 2010 Financial Results 16BioMed Realty Trust Reports Third Quarter 2010 Financial Results 17Stone Age humans needed more brain power to make big leap in tool design 2Scientists produce transparent, light-harvesting material 2
(Date:12/11/2014)... 2014  Data Sciences International (DSI), the global ... new series of digital telemetry implants to meet ... series, part of the PhysioTel™ Digital platform, was ... physiologic data when incorporating functional endpoints into repeat-dose ... toxicology studies has evolved from short ECG strips ...
(Date:12/10/2014)... DIEGO , Dec. 9, 2014 CIE ... collaboration catalyst that provides the connective tissue that enhances ... enabling them to easily share client-level information; earned a ... to expand to organizations serving seniors aging in community ... Diego" partner on December 11 th 4-6p. ...
(Date:12/5/2014)... , Dec. 4, 2014  Tute Genomics, a leader ... million in Series A1 funding led by UK-based Eurovestech. ... participated in the investment round. "We are ... community adopts next-generation sequencing and seeks new approaches for ... Reid Robison , MD MBA, and CEO of Tute ...
Breaking Biology News(10 mins):New telemetry implants expected to change how large animal toxicology studies are conducted 2Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 2Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 3Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 4Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 2Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 3
... You don,t need to spray weedkiller to remove the ... with either boiling water, steam or flaming will dispatch even ... a new PhD project from the University of Copenhagen. ... is important that each treatment is dosed correctly. Basically, ...
... Johns Hopkins scientists have engineered cells that behave like ... on one or more unique inputs. This feat, published in ... eventually help researchers create computers that use cells as tiny ... in the Department of Cell Biology and member of the ...
... BETHESDA, MD May 30, 2012 The Genetics Society ... six graduate students and seven postdoctoral researchers as recipients of ... Each of these early-career geneticists receives a $1,000 travel award ... in a laboratory course of their choice that will enhance ...
Cached Biology News:Blanch your weeds 2Training cells to perform Boolean functions? It's logical 2Training cells to perform Boolean functions? It's logical 3The Genetics Society of America announces DeLill Nasser Travel Award recipients 2
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
... kit contains sufficient materials for 1,464 array sample elements. ... 4 each , Blocker BSA in PBS (10X): ... , BupH Phosphate Buffered Saline: 8 packs ... SuperSignal West Pico Luminol Enhancer: 2 x 25 ml ...
Biology Products: