Navigation Links
Metabolic Pathways Collection at SRI International the Largest in the World
Date:4/24/2013

MENLO PARK, Calif., April 24, 2013 /PRNewswire/ -- Researchers at SRI International, in collaboration with the Boyce Thompson Institute and the Carnegie Institution, have reached a milestone in their development of MetaCyc, a database and web site (MetaCyc.org) that consolidates much known information about metabolism. MetaCyc now includes 2,000 pathways, each a collection of metabolic reactions and the enzymes that catalyze them, making the database the most comprehensive compilation of metabolic pathway information in the world.

MetaCyc catalogs the universe of metabolism—how organisms biochemically transform one compound to another through intricate networks of synthesis and degradation—by integrating many of the biochemical reactions that have been documented in different forms of life. It includes information about more than 10,900 reactions and more than 10,400 compounds from 35,000 cited publications. More than 2,300 organisms are currently represented, from bacteria, archaea and yeast to plants and animals, including humans.

"As researchers know, there are so many scientific articles available that it can be challenging to synthesize all this information," said Peter Karp , Ph.D., director of the Bioinformatics Research Group at SRI International.  "MetaCyc integrates the fragmented, sometimes inaccessible, data throughout the scientific literature. The synthesis of all these individual publications in MetaCyc provides the big picture."

One example is the MetaCyc compound page for L-glutamate, which contains reactions and pathways from a wide variety of organisms that synthesize and degrade this important compound. MetaCyc can reconcile seemingly disparate pathways that involve the same compounds called by different names by different research teams. 

Another contribution of MetaCyc to the scientific enterprise is to combine the published work of ind
'/>"/>

SOURCE SRI International
Copyright©2012 PR Newswire.
All rights reserved

Page: 1 2 3

Related biology technology :

1. Cardiometabolic Health Congress Expert Faculty Evaluate the Clinical Implications of Newly FDA-Approved Treatment for Homozygous Familial Hypercholesterolemia
2. Highly efficient production of advanced biofuel by metabolically engineered microorganism
3. Metabolic engineer synthesizes key breast milk ingredient, makes research possible
4. Profil Institute Continues to Publish New Findings in Metabolic Research
5. MiMedx Group, Inc. to Present at the 6th Annual Canaccord Genuity Cardiovascular, Aesthetics and Metabolic Disorders Conference
6. Merrimack Pharmaceuticals To Present Preliminary Clinical Data For Novel Therapies Targeting Molecular Pathways In Advanced Cancers
7. Sigma Life Science and the Culture Collections of Public Health England Collaborate to Distribute Cells and Cellular Extracts
8. ActiGraph Releases API Supporting Actigraphy Data Collection
9. Inflamax Research Introduces Electronic Patient Data Acquisition Tabletâ„¢ (ePDAT)â„¢ for Real-Time PRO Data Collection
10. Elsevier Offers Entire Collection of Journals and Books to Innovators in Developing Countries Through the Access to Research for Development and Innovation (ARDI) Program
11. Salimetrics Offers New Saliva Collection Aid for Easy Collection of Passive Drool Samples
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:9/19/2014)... YORK, September 18, 2014 Scientists at NYU Langone ... dramatically the efficiency of the process for turning adult ... well-known compounds, including vitamin C. Using the new technique ... cells obtained from adult skin cells by more than ... technique is efficient and reliable, and thus should generally ...
(Date:9/19/2014)... Sept. 19, 2014  Nektar Therapeutics (NASDAQ: ... studies characterizing the analgesic profiles of a series ... receptor agonist molecules. The preclinical research candidates were ... platform. The analgesic properties of kappa ... literature. 1,2 Kappa opioid receptors are expressed ...
(Date:9/19/2014)... -- Dublin ... the addition of the  "Micro Market Monitor : ...      (Logo: http://photos.prnewswire.com/prnh/20130307/600769) , , ,The ... segments in the chromatography market. The market was ... to reach $2.0 billion by 2019, at a ...
(Date:9/18/2014)... -- About POCT POCT, also ... laboratory. It helps in making fast clinical decisions, ... POCT is gaining popularity due to the increasing ... diabetes, heart disease, and obesity. It is generally ... minimize errors during the diagnosis of patients. POCT ...
Breaking Biology Technology:NYU Langone scientists report reliable and highly efficient method for making stem cells 2NYU Langone scientists report reliable and highly efficient method for making stem cells 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 2Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 4Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 5Micro Market Monitor : Global Pre-packed Chromatography Columns 2POCT Market in China 2014-2018 2
... Workshop Set for Sept. 3, UPPSALA, Sweden and ... Bernard de Bruyne, M.D., Ph.D., will present the,benefits of ... the outcomes of multivessel PCI in a workshop at ... The EBAC-accredited,workshop, which is sponsored by Radi Medical Systems, ...
... Cepheid (Nasdaq:,CPHD) will present at the Thomas Weisel ... Hotel, Boston, September 5 to 7, 2007. Chief,Executive ... Finance and,Chief Financial Officer, John R. Sluis will ... The webcast, along with accompanying presentation slides, may ...
... Verenium,Corporation (Nasdaq: VRNM ), a leading developer of ... high-performance specialty,enzymes, announced today that Carlos A. Riva, President ... the Cowen and Company Clean,Energy Conference. The presentation is ... 6, 2007 and will take place at Le Parker ...
Cached Biology Technology:Interventional Cardiologists Nico Pijls, Bernard De Bruyne to Discuss Benefits of Measuring Coronary Pressure in Improving Multivessel PCI at ESC Congress 2007 2Cepheid to Present at Thomas Weisel Partners Healthcare Conference 2Verenium Corporation to Present at the Upcoming Cowen and Company Clean Energy Conference 2Verenium Corporation to Present at the Upcoming Cowen and Company Clean Energy Conference 3
(Date:9/18/2014)... rabbitfish which have devastated algal forests in the eastern ... Mediterranean basin if their distribution continues to expand as ... by an international team of researchers led by Dr ... of the Mediterranean Institute for Advanced Studies in Spain, ... Members of the team surveyed more than 1000 kilometres ...
(Date:9/18/2014)... the ultimate form of camouflage: you don,t just blend ... is not as uncommon as you might think. Kathryn ... explains that the larval life stages of many marine ... the anatomy that most creatures cannot make transparent. Feller ... shield each individual eye unit with an opaque pigment ...
(Date:9/17/2014)... for the Arts and Humanities has received a $260,000 ... two-year project, "The Boundaries of the Human in the ... support a wide-ranging series of events aimed at exploring ... involves artists and researchers who are exploring the boundaries ... of humanism, and the other involves the increasingly influential ...
Breaking Biology News(10 mins):Tropical fish a threat to Mediterranean Sea ecosystems 2Transparent larvae hide opaque eyes behind reflections 2Mellon Foundation awards grant for major project in the humanities and sciences 2
... the immune system, a line of genetically engineered mice can ... of Medicine in St. Louis have found. , Scientists ... system component, a group of molecules known as the Major ... that is similar enough to step in and fill the ...
... to exist and even thrive in surroundings ranging from ... from the Weizmann Institute's Plant Sciences Department, led by ... just two amino acids (the building blocks of protein) ... temperatures and being adapted to living in extreme heat. ...
... has found that large segments of the Pacific Ocean ... the absence of the mineral stresses these microscopic ocean ... ocean productivity appear more robust than it really is. ... data may be inaccurate, the researchers say, and the ...
Cached Biology News:Mice lacking key immune component still control chronic viral infections 2Mice lacking key immune component still control chronic viral infections 3Bacteria beat the heat 2Iron critical to ocean productivity, carbon uptake 2Iron critical to ocean productivity, carbon uptake 3
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
...
... polyclonal antibody raised against a partial recombinant ... (AAH35357, 120 a.a. ~ 250 a.a) partial ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Biology Products: