Navigation Links
Medtech College Recognizes Medical Billers & Coders For "Cracking The Code" Of Insurance, Patient And Physician Billing
Date:6/24/2013

ATLANTA, June 24, 2013 /PRNewswire/ -- In a digital world where virtually all businesses are computerized, everything runs on codes. In healthcare, medical billing and coding specialists are called upon to crack the codes of diagnoses and treatments to ensure patients receive the right treatment, and insurance or physician payment is both timely and accurate.

Responsible for organizing and managing health information, maintaining patient medical and treatment histories, and ensuring the quality, accuracy and security of the information being collected, they might be labeled as "the geeks" of healthcare...but they're much more than that.

Without the billers and coders, the system gets derailed. Theirs is a rewarding profession worthy of recognition.

A preeminent national healthcare education and continuing professional development provider, Medtech College is leading the celebration of these highly trained professionals as its campuses mark Medical Billing and Coding Specialists Week, June 24-28, and Medical Billers and Coders Day on June 26.

All Medtech College and Institute campuses will join in recognizing the significant contributions of medical billers and coders everywhere, and to honor their billing and coding students and staff for their commitment to excelling in this critical healthcare arena.

On Wednesday, June 26, campuses will host a "Crack the Code" Challenge to crown their champion student coders and present a special proclamation recognizing the profession and the campus' most outstanding Medical Billing and Coding Specialist students and instructors. Medtech billing and coding graduates and clinical partners will be invited to the campuses to present helpful tips and industry trends to current students.

"The Medical Billing and Coding Specialist program is an important one and we wish to assume a leading role in recognizing and celebrating our MBCS students and graduates for
'/>"/>

SOURCE Medtech College
Copyright©2012 PR Newswire.
All rights reserved

Page: 1 2 3

Related biology technology :

1. MedTech Innovate Seminars: New Interactive Learning Forums at 2013 MD&M East
2. BioBDx to Present at the 2012 BioPharm America and AdvaMed MedTech Conferences in Boston
3. Medtech Expands Nursing Education Opportunities In Florida
4. MD+DI, the Global MedTech Industry Authority, Wins a 2012 Maggie for Best Overall Category in Medical, Dental & Related Services/Trade
5. MD+DI, the Global MedTech Industry Authority, Wins a 2012 Maggie for Best Cover in the Medical, Dental & Related Services/Trade Category
6. UBM Canon, the Global MedTech Authority, and the Medical Design Excellence Awards Announce Dean Kamen as the Presenter of the 2012 Lifetime Achievement Award
7. Camelot Healthcare Training Institute Acquired by Medtech
8. CardioDx Receives College of American Pathologists (CAP) Accreditation
9. New $40 Million Center for Science and Business Ushers in Cutting-Edge Learning at Monmouth College
10. Lorain County Community College, Austen BioInnovation Institute Join to Advance Medical Technologies
11. Coulter Foundation Surprises Westminster College With One Million Dollar Gift
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:12/17/2014)... (PRWEB) December 17, 2014 Gene ... that it has entered into a technology access ... (ADM) to apply DNA2.0’s proprietary protein engineering technology, ... process. , “We are extremely excited that the ... platform. This proprietary bioengineering technology has now ...
(Date:12/17/2014)... SOUTH SAN FRANCISCO, Calif. , Dec. 17, ... positive results of a Phase 2 study evaluating ... for the treatment of patients with severe, chronic ... the current standard of care, including topical steroids ... endpoint was percent change in Visual Analog Scale ...
(Date:12/15/2014)...  GlassesOff Inc. (OTCBB: GLSO) announced today the appointment ... director of the Company,s Board of Directors. ... its CEO until its acquisition by Stanley Black ... Recognized as the inventor of the first Wi-Fi-based Active ... -based RFID solutions focused on improving operational efficiency, safety ...
(Date:12/13/2014)... (PRWEB) December 12, 2014 Clarassance, a ... announced its new name: Therabron Therapeutics , Inc. ... and bronchioles (a type of structure in the lungs ... company’s mission to develop novel protein therapeutics for the ... directors decided to change the name to mark the ...
Breaking Biology Technology:ADM and DNA2.0 Enter Into Protein Engineering Technology Access and Service Agreement 2Velocity Pharmaceutical Development, LLC and Tigercat Pharma, Inc. Announce Phase 2 Results for VPD-737 in Patients With Chronic Pruritus 2Velocity Pharmaceutical Development, LLC and Tigercat Pharma, Inc. Announce Phase 2 Results for VPD-737 in Patients With Chronic Pruritus 3Velocity Pharmaceutical Development, LLC and Tigercat Pharma, Inc. Announce Phase 2 Results for VPD-737 in Patients With Chronic Pruritus 4AeroScout Founder Joins GlassesOff's Board of Directors 2AeroScout Founder Joins GlassesOff's Board of Directors 3Maryland-based Biotech Company's Path Forward in Treating Respiratory Diseases Sparks Name Change 2
... States Court of Appeals for the Ninth Circuit issued ... v. Netscape Communications Corp. , 9th Cir., No. 00-56648, that ... the Internet. , ,The Playboy case involved "keying," which is ... list of keywords. For instance, a person who searches a ...
... to reboot my washing machine. Not just turning it off ... the power plug from the wall, waited a few moments, ... outlet. Flashing lights, a trill of beeps, and voil: I ... to thinking just how complicated ordinary machines have become, how ...
... joining WTN as a weekly columnist. Her column, The ... opinion articles related to entrepreneurship and venture capital. Particular ... and the lifestyle issues associated with running one's own ... The Millionaire Next Door , which focused on rich ...
Cached Biology Technology:Recent developments in the protection of trademarks on the Internet 2Recent developments in the protection of trademarks on the Internet 3Have you rebooted? 2Have you rebooted? 3Have you rebooted? 4Unique profiles, anecdotes increase Millionaire Womens net worth 2Unique profiles, anecdotes increase Millionaire Womens net worth 3Unique profiles, anecdotes increase Millionaire Womens net worth 4
(Date:12/4/2014)... Fla. , Dec. 3, 2014  Crossmatch™, ... today announced that its DigitalPersona ® Pro ... readers have been deployed throughout First Bank branch ... South Carolina and Virginia. First ... Southern Pines, North Carolina , ...
(Date:11/21/2014)... YORK , Nov. 19, 2014  Earlier this ... at New York College, and one of the most ... biosensor signals that are transmitted from Smartphones to third ... were Smartphones and has one of the earliest known ... discussing its usage in the military, child care, elder ...
(Date:11/18/2014)... -- The Secure Identity & Biometrics Association (SIBA) and ... formation of The Airport Entry and Exit Working ... Biometric Entry and Exit Solutions Framework for Airports ... BORDERPOL, the international non-profit organization that works directly ... border security, traveler and migration systems. ...
Breaking Biology News(10 mins):First Bank Partners with Crossmatch to Increase Log In Security 2First Bank Partners with Crossmatch to Increase Log In Security 3Patented Biosensor Wearable Technology Provides a More Civilized Method of Quarantine 2Patented Biosensor Wearable Technology Provides a More Civilized Method of Quarantine 3Patented Biosensor Wearable Technology Provides a More Civilized Method of Quarantine 4Identity Management, Document Authentication and Biometric Companies Form "The Airport Entry and Exit Working Group", Releasing the Framework to Help Guide the Department of Homeland Security and Congress Towards Solutions 2Identity Management, Document Authentication and Biometric Companies Form "The Airport Entry and Exit Working Group", Releasing the Framework to Help Guide the Department of Homeland Security and Congress Towards Solutions 3
... January 12, 2011 (Toronto) Seven scientists at ... been awarded Young Investigator grant awards by the U.S.-based ... CAMH awards will fund genetic, clinical and neuroimaging studies ... for people with schizophrenia and depression. The ...
... buds on Douglas-fir trees each spring is the result of ... winter, scientists with the U.S. Forest Service,s Pacific Northwest Research ... in the December issue of Science Findings, a monthly publication ... to help managers predict budburst under different scenarios of future ...
... researchers are helping the Pentagon build reliable mind-controlled prosthetic ... rest of their lives. Prosthetic limbs that ... in the laboratory, but there are challenges to making ... obstacles is the neural implants, nearly inevitable failure over ...
Cached Biology News:7 CAMH scientists win Young Investigator awards focused on breakthrough research 27 CAMH scientists win Young Investigator awards focused on breakthrough research 3Winter temperatures play complex role in triggering spring budburst 2University of Houston researchers helping Pentagon build mind-controlled prosthetics 2University of Houston researchers helping Pentagon build mind-controlled prosthetics 3
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... against a partial recombinant FES. ... ~ 250 a.a) partial recombinant protein with ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... AAH35357 OMIM: ...
... raised against a partial recombinant ... PPP4C (NP_002711, 218 a.a. ... protein with GST tag. ... NM_002720 Protein ...
Mouse monoclonal antibody raised against a partial recombinant CAPG. NCBI Entrez Gene ID = CAPG...
Biology Products: