Navigation Links
Medrio, a Leading EDC Provider for Clinical Research, Announces Its Latest Version, 8.1 with iPad Support, is Available Without Charge for Academic Researchers
Date:7/10/2013

San Francisco, CA (PRWEB) July 10, 2013

The user experience of technical software is often disappointing, frequently reflecting more how it’s made than how it’s used. Medrio 8.1 presents a new user interface that is workflow-driven and faster for users. “By observing how both new and experienced researchers do their work, it became clear that there were separate data entry and monitoring workflows which are rarely done at the same time,” said Jeff Johnson, Medrio’s Director of Customer Experience.

Data Entry users need to enroll patients, see what data is scheduled to be entered at the present moment, and respond to queries. Data Monitors, on the other hand, need to see what data needs cleaning, close queries and monitor forms. Each of these workflows can be streamlined. The new 8.1 Medrio user interface is faster, requires fewer clicks to complete common tasks, and is more aesthetically pleasing.

“Additionally, Medrio 8.1 introduces fully validated and 21 CFR part 11 compliant data entry via iPad,” said Michael Farr, Medrio's Manager of Medrio's Scholars. “Although Medrio is not available without charge for commercial studies requiring 21 CFR part 11 compliance, we’ve found that many of our University customers do both academic and commercially sponsored studies and like being able to use one EDC for both. Getting a study database is as simple as visiting scholars.medrio.com and entering an email address."

"Our research program has been using Medrio for less than a year, but has come to rely on the system for a legion of functionality we simply can't get in REDCap. From the forms which can easily be created or copied from our other studies to monitoring, reporting and approval processes; all accessible from any computer using a standard web browser, Medrio is a very compre
'/>"/>

Source: PRWeb
Copyright©2012 Vocus, Inc.
All rights reserved

Page: 1 2

Related biology technology :

1. Medrio, a Leading EDC and eClinical SaaS Provider for Clinical Research, Announces the Highly Anticipated Release of Medrio 8.1 with iPad Support
2. Accel-KKR Makes Growth Equity Investment in Zinc Ahead, Leading Provider of Marketing Compliance Solutions for the Life Sciences Industry
3. Leading Pipette Distributor Pipette.com Now Stocks Transfer Pipettes: Simport’s Dropette and Heathrow Scientific Disposable Plastic Transfer Pipettes
4. Metabolix Executives to Present at Leading Industry Conferences
5. Medical Concierge Travel International launches in Tandem with Leading Medical Cost Containment Company, EME International aimed at Self-Funded and Insurance Companies
6. Alexandrias 499 Illinois Street in Mission Bay, San Francisco, Signs Anchor 97,700 Rentable Square Foot Lease with Leading Mid-Cap Life Science Company
7. Biodetection Technologies 2013 and Oak Ridge National Lab’s Biosurveillance Symposium to Bring Together Leading Organizations in Alexandria, VA from June 17-19, 2013
8. Safe Non-Toxic Enzyme Cleaner Replaces Bleach as Leading Mold & Flood Cleaning Solution
9. PAREXEL International Announces Acquisition of HERON Group LTD, A Leading Commercialization Consultancy
10. Tata Partners with Tel Aviv University to Fund Leading Edge Innovations for Accelerated Commercialization
11. PharmaLeaders: Generic Manufacturers Benchmark Report - Financial Benchmarking & Competitive Analysis of the Leading Generic Players in 2013
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:12/19/2014)... Dec. 18, 2014 Egenix, Inc. is pleased to ... Chairman of the Board, to succeed Donald Fresne ; ... will continue as a member of the Board.  In recognition ... to the company over almost twenty years, the Board designated ... of Directors has established a Search Committee to find a ...
(Date:12/17/2014)... 2014 The Activated Carbon Manufacturing ... is why IBISWorld updated its original industry research report. ... from an intensified focus on environmental policy. Over the ... standards for power plants and a range of other ... Industry Analyst Sarah Kahn, “a range of downstream industrial ...
(Date:12/17/2014)... 17, 2014 Achim Noack has been ... Stoller Group. In this position, Noack will assist Jerry ... matters, develop marketing strategy and supervise global marketing management ... “Achim has tremendous knowledge and experience in the crop ... “His experience and innovative thinking will be a great ...
(Date:12/17/2014)... Dallas, Texas (PRWEB) December 17, 2014 ... research on Global Quartz Tubing industry. For an ... information, definition, classification, application, industry chain structure, industry ... domestic quartz tubing industry has witnessed ... through a number of acquisitions. This report mentions ...
Breaking Biology Technology:Activated Carbon Manufacturing in the US Industry Market Research Report Has Been Updated from IBISWorld 2Activated Carbon Manufacturing in the US Industry Market Research Report Has Been Updated from IBISWorld 3Achim Noack Joins Stoller Group as Global Vice President of Marketing and Administration 22020 Quartz Tubing Market: Global Development & Forecasts Analysis Now at DeepResearchReports.com 2
... BioMed Realty Trust, Inc. (NYSE: BMR ), a real ... Science Industry®, today announced financial results for the third quarter ended ... Generated record total revenues for the third quarter of ... in 2009. Increased rental revenues for the third quarter by ...
... to develop relatively advanced tools after their brains evolved a ... that investigates why it took early humans almost two million ... axe. Researchers used computer modelling and tiny sensors embedded ... humans needed in order to make two types of tools ...
... New Mexico, NOVEMBER 3, 2010Scientists at the U.S. Department ... Laboratory have fabricated transparent thin films capable of absorbing ... area. The material, described in the journal Chemistry ... transparent solar panels. "Potentially, with future refinement of ...
Cached Biology Technology:BioMed Realty Trust Reports Third Quarter 2010 Financial Results 2BioMed Realty Trust Reports Third Quarter 2010 Financial Results 3BioMed Realty Trust Reports Third Quarter 2010 Financial Results 4BioMed Realty Trust Reports Third Quarter 2010 Financial Results 5BioMed Realty Trust Reports Third Quarter 2010 Financial Results 6BioMed Realty Trust Reports Third Quarter 2010 Financial Results 7BioMed Realty Trust Reports Third Quarter 2010 Financial Results 8BioMed Realty Trust Reports Third Quarter 2010 Financial Results 9BioMed Realty Trust Reports Third Quarter 2010 Financial Results 10BioMed Realty Trust Reports Third Quarter 2010 Financial Results 11BioMed Realty Trust Reports Third Quarter 2010 Financial Results 12BioMed Realty Trust Reports Third Quarter 2010 Financial Results 13BioMed Realty Trust Reports Third Quarter 2010 Financial Results 14BioMed Realty Trust Reports Third Quarter 2010 Financial Results 15BioMed Realty Trust Reports Third Quarter 2010 Financial Results 16BioMed Realty Trust Reports Third Quarter 2010 Financial Results 17Stone Age humans needed more brain power to make big leap in tool design 2Scientists produce transparent, light-harvesting material 2
(Date:12/11/2014)... 2014  Data Sciences International (DSI), the global ... new series of digital telemetry implants to meet ... series, part of the PhysioTel™ Digital platform, was ... physiologic data when incorporating functional endpoints into repeat-dose ... toxicology studies has evolved from short ECG strips ...
(Date:12/10/2014)... DIEGO , Dec. 9, 2014 CIE ... collaboration catalyst that provides the connective tissue that enhances ... enabling them to easily share client-level information; earned a ... to expand to organizations serving seniors aging in community ... Diego" partner on December 11 th 4-6p. ...
(Date:12/5/2014)... , Dec. 4, 2014  Tute Genomics, a leader ... million in Series A1 funding led by UK-based Eurovestech. ... participated in the investment round. "We are ... community adopts next-generation sequencing and seeks new approaches for ... Reid Robison , MD MBA, and CEO of Tute ...
Breaking Biology News(10 mins):New telemetry implants expected to change how large animal toxicology studies are conducted 2Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 2Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 3Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 4Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 2Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 3
... You don,t need to spray weedkiller to remove the ... with either boiling water, steam or flaming will dispatch even ... a new PhD project from the University of Copenhagen. ... is important that each treatment is dosed correctly. Basically, ...
... Johns Hopkins scientists have engineered cells that behave like ... on one or more unique inputs. This feat, published in ... eventually help researchers create computers that use cells as tiny ... in the Department of Cell Biology and member of the ...
... BETHESDA, MD May 30, 2012 The Genetics Society ... six graduate students and seven postdoctoral researchers as recipients of ... Each of these early-career geneticists receives a $1,000 travel award ... in a laboratory course of their choice that will enhance ...
Cached Biology News:Blanch your weeds 2Training cells to perform Boolean functions? It's logical 2Training cells to perform Boolean functions? It's logical 3The Genetics Society of America announces DeLill Nasser Travel Award recipients 2
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
... kit contains sufficient materials for 1,464 array sample elements. ... 4 each , Blocker BSA in PBS (10X): ... , BupH Phosphate Buffered Saline: 8 packs ... SuperSignal West Pico Luminol Enhancer: 2 x 25 ml ...
Biology Products: