Navigation Links
Medical University of South Carolina Selects Elsevier's Interdisciplinary Care Planning and Clinical Documentation Solution
Date:3/26/2013

as well as provide the tools they need to document and monitor that care.

"Integrating CPM CarePoints into MUSC will support the center's focus on providing interdisciplinary care planning, clinical documentation and reliable clinical practice guidelines," said Michelle Troseth , Executive Vice President and Chief Professional Practice Officer of Elsevier. "Both MUSC and Elsevier share the goal of providing superior, evidence-based solutions to clinicians. We believe our collaboration will strengthen MUSC's quality of care, improve clinical outcomes and enhance patient safety."

About MUSC


Founded in 1824 in Charleston, The Medical University of South Carolina is the oldest medical school in the South. Today, MUSC continues the tradition of excellence in education, research, and patient care. MUSC educates and trains more than 3,000 students and residents, and has nearly 13,000 employees, including approximately 1,500 faculty members. As the largest non-federal employer in Charleston, the university and its affiliates have collective annual budgets in excess of $1.7 billion. MUSC operates a 750-bed medical center, which includes a nationally recognized Children's Hospital, the Ashley River Tower (cardiovascular, digestive disease, and surgical oncology), and a leading Institute of Psychiatry. For more information on academic information or clinical services, visit http://www.musc.edu. For more information on hospital patient services, visit http://www.muschealth.com

About Elsevier

Elsevier is a world-leading provider of scientific, technical and medical information products and services. The company works in partnership with the global science and health communities to publish more than 2,000 journals, including The Lancet and
'/>"/>

SOURCE Elsevier
Copyright©2012 PR Newswire.
All rights reserved

Page: 1 2 3

Related biology technology :

1. Roche NimbleGen and BGI Develop Advanced MHC Region Capture Technology for Human Disease and Biomedical Research
2. DiaTech Life Sciences Announces Medical Advisory Board
3. Van Andel Institute Partners with UNCF to Recruit Students to Biomedical Research Careers
4. Breaking Study: ICU Medicals Tego® Needlefree Connector Proves More Cost Effective Than Traditional Central Venous Catheter Locks
5. China Sky One Medical to Jointly Launch Adult Stem Cell Research Enterprise
6. Varian Medical Systems Schedules First Quarter FY2012 News Release and Conference Call
7. HealthCare Institute of New Jersey Releases 2011 Biopharmaceutical and Medical Technology Economic Impact Data
8. Saladax Biomedical, Inc. to Present at Biotech Showcase™ 2012
9. Live Press Briefing on Findings of Biomedical Industry CEO Survey
10. Saladax Biomedical, Inc. Issued Six Patents Containing Broad Claims in the Immunoassay Space
11. Scott Brooks Joins Regenesis Biomedical as Chief Operating Officer
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:9/19/2014)... YORK, September 18, 2014 Scientists at NYU Langone ... dramatically the efficiency of the process for turning adult ... well-known compounds, including vitamin C. Using the new technique ... cells obtained from adult skin cells by more than ... technique is efficient and reliable, and thus should generally ...
(Date:9/19/2014)... Sept. 19, 2014  Nektar Therapeutics (NASDAQ: ... studies characterizing the analgesic profiles of a series ... receptor agonist molecules. The preclinical research candidates were ... platform. The analgesic properties of kappa ... literature. 1,2 Kappa opioid receptors are expressed ...
(Date:9/19/2014)... -- Dublin ... the addition of the  "Micro Market Monitor : ...      (Logo: http://photos.prnewswire.com/prnh/20130307/600769) , , ,The ... segments in the chromatography market. The market was ... to reach $2.0 billion by 2019, at a ...
(Date:9/18/2014)... -- About POCT POCT, also ... laboratory. It helps in making fast clinical decisions, ... POCT is gaining popularity due to the increasing ... diabetes, heart disease, and obesity. It is generally ... minimize errors during the diagnosis of patients. POCT ...
Breaking Biology Technology:NYU Langone scientists report reliable and highly efficient method for making stem cells 2NYU Langone scientists report reliable and highly efficient method for making stem cells 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 2Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 4Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 5Micro Market Monitor : Global Pre-packed Chromatography Columns 2POCT Market in China 2014-2018 2
... , ... computational drug discovery solutions provider, announced today they have licensed ... Drug Administration,s National Center for Toxicological Research (NCTR). , Under ... access to the complete TIP structural knowledgebase via ...
... , NEW ORLEANS, Dec. 8 HemaQuest Pharmaceuticals presented data ... of its lead drug candidate, HQK-1001, in sickle cell disease ... Society of Hematology in New Orleans. The preclinical studies ... of therapeutic agents that have been used in the past ...
... ... Extended Wear Hearing Aid. , ... Newark, CA (PRWEB) December 8, 2009 -- Whether it’s a crackling fire, jingling sleigh bells, ... miss out on the joyous sounds of the holidays. Lyric, the first 100% invisible ...
Cached Biology Technology:Eidogen-Sertanty Licenses TIP to the FDA 2HemaQuest Pharmaceuticals Presents Promising Results in Sickle Cell Disease and Beta Thalassemia 2HemaQuest Pharmaceuticals Presents Promising Results in Sickle Cell Disease and Beta Thalassemia 3Lyric Presents the Sounds of the Season 2
(Date:9/18/2014)... rabbitfish which have devastated algal forests in the eastern ... Mediterranean basin if their distribution continues to expand as ... by an international team of researchers led by Dr ... of the Mediterranean Institute for Advanced Studies in Spain, ... Members of the team surveyed more than 1000 kilometres ...
(Date:9/18/2014)... the ultimate form of camouflage: you don,t just blend ... is not as uncommon as you might think. Kathryn ... explains that the larval life stages of many marine ... the anatomy that most creatures cannot make transparent. Feller ... shield each individual eye unit with an opaque pigment ...
(Date:9/17/2014)... for the Arts and Humanities has received a $260,000 ... two-year project, "The Boundaries of the Human in the ... support a wide-ranging series of events aimed at exploring ... involves artists and researchers who are exploring the boundaries ... of humanism, and the other involves the increasingly influential ...
Breaking Biology News(10 mins):Tropical fish a threat to Mediterranean Sea ecosystems 2Transparent larvae hide opaque eyes behind reflections 2Mellon Foundation awards grant for major project in the humanities and sciences 2
... DNA is copied into ribonucleic acid (RNA) molecules, also ... making proteins, and a collection of all the transcripts ... Jaiswal, Assistant Professor of Botany and Plant Pathology at ... Jaiswal,s laboratory, and colleagues assembled transcriptomes of a noxious ...
... AMHERST, Mass. Biochemists at the University of Massachusetts ... insight into how protein synthesis and degradation help to ... they reveal how two proteins shelter each other in ... and safely. Cells must routinely dispose of leftover ...
... University of Florida paleontologists have discovered remarkably well-preserved fossils ... science during recent Panama Canal excavations that began in ... and an extinct hippo-like species inhabited Central America during ... expands the range of ancient animals in the subtropics ...
Cached Biology News:Assembling the transcriptome of a noxious weed: New resources for studying how plants invade 2New insight into double-protected dance of cell division 2UF scientists discover new crocodilian, hippo-like species from Panama 2UF scientists discover new crocodilian, hippo-like species from Panama 3
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
...
... polyclonal antibody raised against a partial recombinant ... (AAH35357, 120 a.a. ~ 250 a.a) partial ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Biology Products: