Navigation Links
Medical Marijuana Inc., Corporate Update- Significant Revenue and Net Income Growth 1st Quarter- Division and Corporate Holdings Update

e seen medical marijuana being legalized in Italy and the Czech Republic, with nearly a dozen more countries in discussion of legalization for medical and\or recreational use. The company has set up a distribution network of pharmacies, clinics, wellness centers and retail stores that will allow us to offer our products to this developing market. 

Canipa has finalized its terms for marketing, sales and manufacturing for 20 plus of its products for the EU and US markets. Of these products, 22 have along with the manufacturing agreements, received EU Certificate of Health Safety Free Sale Certificates. This is one of the most significant developments in the Medical Marijuana Inc. product development. These products will be available through our entire pipeline of distribution and will over the coming quarters cross promote and develop brands for the US\EU markets that address different consumer audiences and demographics.

Additional highlights-

Company launching its corporate and sales sites online. These sites will initially have the EU approved products for sale on them, but will be rapidly focus on integrating our entire portfolio of MJNA products.

The company is in negotiations with senior level political lobbyist in regards to additional product approvals, as well as working with them to educate the regulatory authorities on the use of cannabis based products. The company is actively pursuing with these regulatory authorities the integration of MJNA services in the fields of Seed to sale tracking, compliance, grow technologies, packaging, process, testing and product licensing.  

HempMeds – HempMeds was established to develop online platforms for the marketing and sales of cannabis\hemp based consumer products. The company has been in development of its platform and actively acquiring IP, additional online properties, marketing and awareness partners fo

SOURCE Medical Marijuana, Inc.
Copyright©2012 PR Newswire.
All rights reserved

Page: 1 2 3 4 5 6 7 8 9 10 11 12

Related biology technology :

1. First Warning Systems, Inc., Appoints Veteran Medical Executive Royea as CEO
2. Seahorse Bioscience Launches First Product from the Partnership with Baystate Medical Center and UMass Amherst
3. Medical University of South Carolina Selects Elseviers Interdisciplinary Care Planning and Clinical Documentation Solution
4. Final Week of IpAuctions, Inc. All Things Medical Auction Event
5. Cellular Dynamics and Coriell Institute for Medical Research Awarded Multi-Million Dollar Grants from California Institute for Regenerative Medicine to Manufacture and Bank Stem Cell Lines
6. Clinical Trials and Medical Research in Texas Create Jobs and Save Lives
7. Medical Gases and Equipment Market is Expected to Reach USD 9 Billion Globally in 2018: Transparency Market Research
8. New Opportunity: The Biomedical Innovations of Tomorrow - Research Report on PhotoMedex, Axiall Corp, Varian Medical Systems, Volcano Corporation and Navidea Biopharmaceuticals
9. Astute Medical, Inc. va Accueillir le Symposium portant sur linsuffisance rénale du 33e ISICEM annuel
10. Astute Medical, INC. ist Veranstalter eines SYMPOSIUMS zu Nierenerkrankungen beim 33. jährlichen ISICEM
11. Astute Medical, Inc. organizará el 33. simposio anual en el congreso ISICEM sobre daño renal
Post Your Comments:
(Date:9/19/2014)... YORK, September 18, 2014 Scientists at NYU Langone ... dramatically the efficiency of the process for turning adult ... well-known compounds, including vitamin C. Using the new technique ... cells obtained from adult skin cells by more than ... technique is efficient and reliable, and thus should generally ...
(Date:9/19/2014)... Sept. 19, 2014  Nektar Therapeutics (NASDAQ: ... studies characterizing the analgesic profiles of a series ... receptor agonist molecules. The preclinical research candidates were ... platform. The analgesic properties of kappa ... literature. 1,2 Kappa opioid receptors are expressed ...
(Date:9/19/2014)... -- Dublin ... the addition of the  "Micro Market Monitor : ...      (Logo: , , ,The ... segments in the chromatography market. The market was ... to reach $2.0 billion by 2019, at a ...
(Date:9/18/2014)... -- About POCT POCT, also ... laboratory. It helps in making fast clinical decisions, ... POCT is gaining popularity due to the increasing ... diabetes, heart disease, and obesity. It is generally ... minimize errors during the diagnosis of patients. POCT ...
Breaking Biology Technology:NYU Langone scientists report reliable and highly efficient method for making stem cells 2NYU Langone scientists report reliable and highly efficient method for making stem cells 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 2Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 4Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 5Micro Market Monitor : Global Pre-packed Chromatography Columns 2POCT Market in China 2014-2018 2
... , ... computational drug discovery solutions provider, announced today they have licensed ... Drug Administration,s National Center for Toxicological Research (NCTR). , Under ... access to the complete TIP structural knowledgebase via ...
... , NEW ORLEANS, Dec. 8 HemaQuest Pharmaceuticals presented data ... of its lead drug candidate, HQK-1001, in sickle cell disease ... Society of Hematology in New Orleans. The preclinical studies ... of therapeutic agents that have been used in the past ...
... ... Extended Wear Hearing Aid. , ... Newark, CA (PRWEB) December 8, 2009 -- Whether it’s a crackling fire, jingling sleigh bells, ... miss out on the joyous sounds of the holidays. Lyric, the first 100% invisible ...
Cached Biology Technology:Eidogen-Sertanty Licenses TIP to the FDA 2HemaQuest Pharmaceuticals Presents Promising Results in Sickle Cell Disease and Beta Thalassemia 2HemaQuest Pharmaceuticals Presents Promising Results in Sickle Cell Disease and Beta Thalassemia 3Lyric Presents the Sounds of the Season 2
(Date:9/18/2014)... and their colleagues have built the first smartphone ... performance and behavioral trends. In other words, your ... if you don,t -- and how that affects ... happiness, stress, depression and loneliness to their academic ... population for example, to monitor mental health, ...
(Date:9/18/2014)... celebrated tonight at the third annual Golden Goose Award ... premature infants and in paving the way for the ... supported by the National Science Foundation, the National Institutes ... be honored at a ceremony at the Library of ... of Congress will be on hand to help present ...
(Date:9/18/2014)... when people are too stressed they are often grouchy, ... Mind Institute (BMI) at EPFL have just highlighted a ... stress and the loss of social skills and cognitive ... synaptic regulatory molecule in the brain. This was revealed ... , Carmen Sandi,s team went to look for ...
Breaking Biology News(10 mins):New Dartmouth smartphone app reveals users' mental health, performance, behavior 2New Dartmouth smartphone app reveals users' mental health, performance, behavior 3New Dartmouth smartphone app reveals users' mental health, performance, behavior 43rd annual Golden Goose award ceremony honors 8 researchers; Unusual work had big results 2How stress tears us apart 2
... DNA is copied into ribonucleic acid (RNA) molecules, also ... making proteins, and a collection of all the transcripts ... Jaiswal, Assistant Professor of Botany and Plant Pathology at ... Jaiswal,s laboratory, and colleagues assembled transcriptomes of a noxious ...
... AMHERST, Mass. Biochemists at the University of Massachusetts ... insight into how protein synthesis and degradation help to ... they reveal how two proteins shelter each other in ... and safely. Cells must routinely dispose of leftover ...
... University of Florida paleontologists have discovered remarkably well-preserved fossils ... science during recent Panama Canal excavations that began in ... and an extinct hippo-like species inhabited Central America during ... expands the range of ancient animals in the subtropics ...
Cached Biology News:Assembling the transcriptome of a noxious weed: New resources for studying how plants invade 2New insight into double-protected dance of cell division 2UF scientists discover new crocodilian, hippo-like species from Panama 2UF scientists discover new crocodilian, hippo-like species from Panama 3
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... polyclonal antibody raised against a partial recombinant ... (AAH35357, 120 a.a. ~ 250 a.a) partial ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Biology Products: