Navigation Links
MC Leeuwarden Selects ClinicalKey
Date:1/28/2013

AMSTERDAM, January 28, 2013 /PRNewswire/ --

Hospital in the Netherlands provides 650 clinicians access to Elsevier's 'clinical insight engine,' which delivers the most current clinically relevant, evidence-based answers

Elsevier, a world-leading provider of scientific, technical and medical information products and services, today announced that MC Leeuwarden will provide its 650 clinicians with access to ClinicalKey, Elsevier's pioneering "clinical insight engine." MC Leeuwarden is part of a select group of hospitals in the Netherlands called the STZ (the association of tertiary medical teaching hospitals).

Under the terms of the agreement, MC Leeuwarden will have access to ClinicalKey the tool's content, which includes more than 900 textbooks, 500 top medical journals and 9,000 procedural videos, providing the most current clinically relevant evidence-based answers, as well as expert commentary, MEDLINE abstracts and select third-party journals.

"Fast access to the most current up-to-date medical and scientific information is a vital element for clinician's in their daily workflow.  We were really impressed with ClinicalKey and what it has to offer," said Jelle Prins , Dean of the MC Leeuwarden Academy.  "Clinical excellence is a big priority for us, and we are confident that this tool can help us to get access to the core-information and that it will provide our professionals with the latest state-of-the-art functionality.  The way in which ClinicalKey presents its information is of real added value to our clinicians and organization."

Launched in April 2012, ClinicalKey provides the most current clinically relevant evidenc
'/>"/>

SOURCE Elsevier
Copyright©2012 PR Newswire.
All rights reserved

0

GOOD

Page: 1 2 3

Related biology technology :

1. Islet Sciences, Inc. Selects NeoStems Manufacturing Subsidiary Progenitor Cell Therapy for Product Manufacturing
2. Netsmart Selects Overland Park, Kansas, for New Office
3. Pharmaceutical Consortium Selects BioFortis Software to Manage Collaborative Clinical Data and Biobanking Activities
4. Maine Center for Creativity Selects Glenn Close and David Shaw to Receive Inaugural Maine Creative Industry Award
5. Aesthetics Pharmaceutical Company Selects 360 Vantage Closed Loop Marketing Solution for Apple iPad
6. Eaton Apothecary Selects Predictive Acquisition Cost (PAC) Drug Price Type
7. Bellicum Selects DATATRAK Solution for Drug Program
8. University of California, San Francisco (UCSF) Selects Conflict of Interest Management System
9. INC Research Selects MetricStream to Strengthen Compliance Management
10. Genomatica, Inc., Award-Winning Industrial Biotechnology Pioneer, Selects Alexandria Real Estate Equities, Inc. for Long-Term, Mission-Critical R&D Facility and Corporate Headquarters
11. Moscow State University Hospital Selects Ekahau RTLS to Improve Operations and Patient Safety
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:6/19/2013)... , June 19, 2013 ... ) has announced the addition of the ... Opportunities, 2018" report to their offering. ... Lack of data protection and old ... PIN codes have driven the growth of ...
(Date:6/19/2013)... -- Continuing its long history of proven clinical performance in ... Inc. announces the U.S. Food and Drug Administration (FDA) ... assay for use on its Access 2 immunoassay system. ... Coulter,s troponin I test for over 12 years ... to continue providing dependability to laboratories supporting emergency care," ...
(Date:6/19/2013)... 2013 Biotechnology industry pioneer Amgen (NASDAQ: ... provider BlackLine Systems  and enterprise application software leader ... a webinar next week entitled "No Account Left Behind!  ... SAP to Help Keep Its Account Reconciliations in Good Shape ... The webinar, geared at finance, accounting, audit and ...
(Date:6/19/2013)... (PRWEB) June 19, 2013 Applied Rigaku ... report that details the measurement of sulfur in ultra-low ... QC+ high resolution benchtop EDXRF analyzer . The analysis ... test method ISO 13032. This International Standard specifies ... the determination of sulfur content in automotive gasoline. , ...
Breaking Biology Technology:Global Biometric Systems Market Forecast Report - Opportunities to 2018 2Global Biometric Systems Market Forecast Report - Opportunities to 2018 3Beckman Coulter Announces FDA Clearance of New Access AccuTnI+3 Troponin I Assay for the Access 2 Immunoassay System 2Beckman Coulter Announces FDA Clearance of New Access AccuTnI+3 Troponin I Assay for the Access 2 Immunoassay System 3Amgen Joins BlackLine Systems, SAP for Webinar on Automating Account Reconciliations 2Amgen Joins BlackLine Systems, SAP for Webinar on Automating Account Reconciliations 3Amgen Joins BlackLine Systems, SAP for Webinar on Automating Account Reconciliations 4Rigaku Publishes New Application Note for Analysis of ULSD Per ISO 13032 2
... MOUNTAIN VIEW, Calif., Jan. 17, 2012  MAP Pharmaceuticals, Inc. (Nasdaq: ... James O,Shea to its Board of Directors. Mr. O,Shea brings ... product commercialization and operations. "We are privileged to ... time in the Company,s development as we focus our efforts ...
... 16, 2012 Luminex Corporation (Nasdaq: LMNX ) ... fourth quarter and full year 2011 on Monday, February 6, ... release after the close of trading. (Logo: ... conference call to discuss the operating highlights and financial results ...
... 2012 Elsevier, a world-leading provider ... services, announced today that its first bilingual platform of ... , is now available online. NursingChina ... available in China, featuring skills within specialties such ...
Cached Biology Technology:MAP Pharmaceuticals Appoints W. James O'Shea to Board of Directors 2MAP Pharmaceuticals Appoints W. James O'Shea to Board of Directors 3Luminex Corporation Fourth Quarter and Full Year 2011 Earnings Release Scheduled for February 6, 2012 2Luminex Corporation Fourth Quarter and Full Year 2011 Earnings Release Scheduled for February 6, 2012 3Elsevier Launches Bilingual International Nursing Skill Training and Management Platform: NursingChina.com 2Elsevier Launches Bilingual International Nursing Skill Training and Management Platform: NursingChina.com 3
(Date:6/19/2013)... MOUNTAIN VIEW, Calif. , June 20, 2013 ... the personalized cosmeceuticals market, Frost & Sullivan recognizes ... Sullivan Award for New Product Innovation. geneOnyx leverages ... point-of-care testing to create an on-the-spot genetic test ... only a single-step DNA collection procedure from saliva ...
(Date:6/19/2013)... is playing a vital role in the survival of ... to climate and environmental changes, according to new research ... savannah birds from the Tanzanian Bird Atlas project - ... - the researchers found that they are using protected ... further west where dry seasons are getting longer, with ...
(Date:6/19/2013)... 19, 2013   Mercy Medical Center ... technology for conducting on-demand, Hemoglobin A 1c ... well as analysis of important red blood ... The new system enables the hospital to ... physicians and their patients, which can improve ...
Breaking Biology News(10 mins):Frost & Sullivan Applauds geneOnyx for its DNA Testing Solution for the Personalized Cosmeceuticals Market 2Frost & Sullivan Applauds geneOnyx for its DNA Testing Solution for the Personalized Cosmeceuticals Market 3Frost & Sullivan Applauds geneOnyx for its DNA Testing Solution for the Personalized Cosmeceuticals Market 4Protected areas provide African birds with stepping stones to survival 2Mercy Lab Offers Faster On-demand Diabetes Testing, Cellular Studies 2Mercy Lab Offers Faster On-demand Diabetes Testing, Cellular Studies 3Mercy Lab Offers Faster On-demand Diabetes Testing, Cellular Studies 4
... in biomedical science are on the horizon with ... Infrastructure (Instruct) in support of European biomedical research. ... (ESFRI) is involved in establishing about 40 such ... is one such biomedical project, whose aim is ...
... center responsible for responding goes into gear, setting off a ... from the adrenal glands. Dr. Gil Levkowitz ... now revealed a new kind of ON-OFF switch in the ... from the brain that stimulates cortisol release in the body. ...
... by a University of California, Davis, plant scientist delivers a ... world-renowned wine industry. The study is set for publication ... the Proceedings of the National Academy of Sciences. "Many ... plant, but we believe that most microbes would have difficulty ...
Cached Biology News:European Integrated Structural Biology Infrastructure launching 2A unique on-off switch for hormone production 2Fused genes tackle deadly Pierce's disease in grapevines 2
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Mouse monoclonal antibody raised against a full length recombinant GPT. NCBI Entrez Gene ID = GPT...
Rabbit polyclonal antibody to GluR2...
Biology Products: