Navigation Links
Leading Biotechnology Company Grows with StayinFront CRM
Date:10/4/2007

- StayinFront's Ability to Support Expanding Customer Base and Complex

Business Processes Cited as Critical to Decision -

FAIRFIELD, N.J., Oct. 4 /PRNewswire/ StayinFront, Inc., a global provider of enterprise wide customer relationship management (CRM) applications, decision support tools, data services and eBusiness systems, today announced that a leading biotechnology company signed a three-year agreement selecting StayinFront CRM Version 10 as its customer relationship management system for its U.S.-based operations. The agreement includes a range of support services from StayinFront.

The company has a global workforce of close to 18,000 and is represented in more than 120 countries. Balancing their customer relationship management needs with the highly dynamic nature of their industry, as well as complex data requirements, led them to evaluate a wide range of leading CRM packages, including traditional ERP solutions and those from "dot-com" providers. StayinFront CRM was selected because in addition to providing CRM capabilities to the biotechnology company's sales force, StayinFront could also support the marketing and field service organizations.

"This client understands the true success factors for CRM and we're honored that their careful analysis of CRM vendors led them to choose StayinFront. This new collaboration in the United States market, added to our existing relationship with them in Canada, makes this a key North American partnership for both companies," said Ken Arbadji, vice president of North American sales for StayinFront.

About StayinFront CRM

Designed to provide a single technology platform that manages and integrates all aspects of customer interaction, including sales, marketing, and customer support, StayinFront CRM is an enterprise-wide "exact fit" solution. Rapidly configured to meet the specific needs of each client, StayinFront CRM's unique product architecture can integrate into exis
'/>"/>

SOURCE StayinFront, Inc.
Copyright©2007 PR Newswire.
All rights reserved

Page: 1 2 3

Related biology technology :

1. Visions, Part II: Preizler sees IT leading incremental health system change
2. Waisman director leading early stages of the Wisconsin Institutes for Discovery
3. NimbleGen partners with leading researchers
4. Leading global Big Pharma companies of 2005
5. Leading cancer institute to install three TomoTherapy systems
6. The worlds leading biotech companies
7. Olympics of biotechnology has international flavor
8. Making Wisconsin the biotechnology leader
9. Let the olympics of biotechnology in the Midwest begin!
10. The mushrooming of biotechnology in the U.S.
11. 42 days until the 2006 Olympics of Biotechnology in Chicago
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:9/19/2014)... YORK, September 18, 2014 Scientists at NYU Langone ... dramatically the efficiency of the process for turning adult ... well-known compounds, including vitamin C. Using the new technique ... cells obtained from adult skin cells by more than ... technique is efficient and reliable, and thus should generally ...
(Date:9/19/2014)... Sept. 19, 2014  Nektar Therapeutics (NASDAQ: ... studies characterizing the analgesic profiles of a series ... receptor agonist molecules. The preclinical research candidates were ... platform. The analgesic properties of kappa ... literature. 1,2 Kappa opioid receptors are expressed ...
(Date:9/19/2014)... -- Dublin ... the addition of the  "Micro Market Monitor : ...      (Logo: http://photos.prnewswire.com/prnh/20130307/600769) , , ,The ... segments in the chromatography market. The market was ... to reach $2.0 billion by 2019, at a ...
(Date:9/18/2014)... -- About POCT POCT, also ... laboratory. It helps in making fast clinical decisions, ... POCT is gaining popularity due to the increasing ... diabetes, heart disease, and obesity. It is generally ... minimize errors during the diagnosis of patients. POCT ...
Breaking Biology Technology:NYU Langone scientists report reliable and highly efficient method for making stem cells 2NYU Langone scientists report reliable and highly efficient method for making stem cells 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 2Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 4Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 5Micro Market Monitor : Global Pre-packed Chromatography Columns 2POCT Market in China 2014-2018 2
... , ... computational drug discovery solutions provider, announced today they have licensed ... Drug Administration,s National Center for Toxicological Research (NCTR). , Under ... access to the complete TIP structural knowledgebase via ...
... , NEW ORLEANS, Dec. 8 HemaQuest Pharmaceuticals presented data ... of its lead drug candidate, HQK-1001, in sickle cell disease ... Society of Hematology in New Orleans. The preclinical studies ... of therapeutic agents that have been used in the past ...
... ... Extended Wear Hearing Aid. , ... Newark, CA (PRWEB) December 8, 2009 -- Whether it’s a crackling fire, jingling sleigh bells, ... miss out on the joyous sounds of the holidays. Lyric, the first 100% invisible ...
Cached Biology Technology:Eidogen-Sertanty Licenses TIP to the FDA 2HemaQuest Pharmaceuticals Presents Promising Results in Sickle Cell Disease and Beta Thalassemia 2HemaQuest Pharmaceuticals Presents Promising Results in Sickle Cell Disease and Beta Thalassemia 3Lyric Presents the Sounds of the Season 2
(Date:9/18/2014)... and their colleagues have built the first smartphone ... performance and behavioral trends. In other words, your ... if you don,t -- and how that affects ... happiness, stress, depression and loneliness to their academic ... population for example, to monitor mental health, ...
(Date:9/18/2014)... celebrated tonight at the third annual Golden Goose Award ... premature infants and in paving the way for the ... supported by the National Science Foundation, the National Institutes ... be honored at a ceremony at the Library of ... of Congress will be on hand to help present ...
(Date:9/18/2014)... when people are too stressed they are often grouchy, ... Mind Institute (BMI) at EPFL have just highlighted a ... stress and the loss of social skills and cognitive ... synaptic regulatory molecule in the brain. This was revealed ... , Carmen Sandi,s team went to look for ...
Breaking Biology News(10 mins):New Dartmouth smartphone app reveals users' mental health, performance, behavior 2New Dartmouth smartphone app reveals users' mental health, performance, behavior 3New Dartmouth smartphone app reveals users' mental health, performance, behavior 43rd annual Golden Goose award ceremony honors 8 researchers; Unusual work had big results 2How stress tears us apart 2
... DNA is copied into ribonucleic acid (RNA) molecules, also ... making proteins, and a collection of all the transcripts ... Jaiswal, Assistant Professor of Botany and Plant Pathology at ... Jaiswal,s laboratory, and colleagues assembled transcriptomes of a noxious ...
... AMHERST, Mass. Biochemists at the University of Massachusetts ... insight into how protein synthesis and degradation help to ... they reveal how two proteins shelter each other in ... and safely. Cells must routinely dispose of leftover ...
... University of Florida paleontologists have discovered remarkably well-preserved fossils ... science during recent Panama Canal excavations that began in ... and an extinct hippo-like species inhabited Central America during ... expands the range of ancient animals in the subtropics ...
Cached Biology News:Assembling the transcriptome of a noxious weed: New resources for studying how plants invade 2New insight into double-protected dance of cell division 2UF scientists discover new crocodilian, hippo-like species from Panama 2UF scientists discover new crocodilian, hippo-like species from Panama 3
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
...
... polyclonal antibody raised against a partial recombinant ... (AAH35357, 120 a.a. ~ 250 a.a) partial ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Biology Products: