Navigation Links
Kiwa Bio-Tech Signs RMB 150 Million (US$21+ million) Fertilizer Contract
Date:7/28/2008

BEIJING and CLAREMONT, Calif., July 28 /Xinhua-PRNewswire-FirstCall/ -- Kiwa Bio-Tech Products Group Corporation (OTC Bulletin Board: KWBT) announces that Kiwa Bio-Tech Products (Shandong) Co., Ltd. (Kiwa Shandong) signed fertilizer sales contracts totaling RMB 150 million (over US$21 million) with Jilin Tianma Science & Technology of Agriculture Co., Ltd. and other distributors. Delivery of products under these contracts will be carried out from August 2008 through March 2009.

Prior to entering into these Agreements, Kiwa Shandong has received approval from the Ministry of Commerce of PRC for wholesaling other companies' fertilizer products; updated its business registration; and filed for exemption from VAT, under applicable Chinese laws and regulations. The Company has also entered into purchase contracts with Jiangsu Zhongdong Group for relevant fertilizer products.

Kiwa Shandong has recently adjusted its product mix in cooperation with Jiangsu Zhongdong Fertilizer Group with a focus on developing new compound bio-fertilizers. Kiwa Shandong is also continuing to develop new organic fertilizers to meet customer demand and is expected to introduce new bio-fertilizer products for sale in the Chinese fertilizer markets by the end of 2008. Starting in June 2008, Kiwa has been working closely with Jiangsu Zhongdong Group Co., Ltd. ("Zhongdong") to develop and market products. This announcement reflects contracts signed as part of previously announced sales expectations of US$10,000,000 in the next six months.

Mr. Wei Li, CEO and Chairman of the Company, stated, "We are pleased by the number of new customers and very large contracts signed at the end of June 2008. Delivery of these fertilizer products and recognition of revenues will begin in and significantly raise revenues in the third quarter. While second quarter revenues will be improved they will not reflect the significant rapid growth we expect in the second half of 2008."

Mr.
'/>"/>

SOURCE Kiwa Bio-Tech Products Group Corporation
Copyright©2008 PR Newswire.
All rights reserved

Page: 1 2 3

Related biology technology :

1. Kiwa Bio-Tech Receives Authorization From the Ministry of Commerce of the Peoples Republic of China to Wholesale Other Fertilizer Manufacturers Products
2. Kiwa Bio-Tech Joint Venture to Produce Preventative for Avian Flu
3. Kiwa Bio-Tech in Collaboration Discussions with Beijing Hai Xin Science and Technology Co., Ltd.
4. Kiwa Bio-Tech Passes Test & Taking Orders From Beijing Lv Fu Long Vegetable Company
5. Kiwa Bio-Tech Confirms Joint Venture Agreement With Shijiazhuang Huaxing Animal Medicine Co., Ltd.
6. Kiwa Bio-Tech 1st Quarter Revenues Increase 57.8% - $2.18 Million
7. Kiwa Bio-Tech Year-End Revenues Increase 264% - Exceed $9.1 Million
8. Kiwa Bio-Tech New Bio-Fertilizer Product Granted Initial Fertilizer Registration Certificate By Ministry of Agriculture of the PRC
9. Kiwa Bio-Tech Products Group Discusses Cooperative Research With the University of Waterloo, Canada
10. Kiwa Bio-Tech Products Group Discusses Cooperative Efforts With Canadian Agricultural Ministry and Canadian Company
11. Kiwa Bio-Tech Ships 114 Tons of Bio-Fertilizer in Fourth Quarter of 2007
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:12/17/2014)... (PRWEB) December 17, 2014 Gene ... that it has entered into a technology access ... (ADM) to apply DNA2.0’s proprietary protein engineering technology, ... process. , “We are extremely excited that the ... platform. This proprietary bioengineering technology has now ...
(Date:12/17/2014)... SOUTH SAN FRANCISCO, Calif. , Dec. 17, ... positive results of a Phase 2 study evaluating ... for the treatment of patients with severe, chronic ... the current standard of care, including topical steroids ... endpoint was percent change in Visual Analog Scale ...
(Date:12/15/2014)...  GlassesOff Inc. (OTCBB: GLSO) announced today the appointment ... director of the Company,s Board of Directors. ... its CEO until its acquisition by Stanley Black ... Recognized as the inventor of the first Wi-Fi-based Active ... -based RFID solutions focused on improving operational efficiency, safety ...
(Date:12/13/2014)... (PRWEB) December 12, 2014 Clarassance, a ... announced its new name: Therabron Therapeutics , Inc. ... and bronchioles (a type of structure in the lungs ... company’s mission to develop novel protein therapeutics for the ... directors decided to change the name to mark the ...
Breaking Biology Technology:ADM and DNA2.0 Enter Into Protein Engineering Technology Access and Service Agreement 2Velocity Pharmaceutical Development, LLC and Tigercat Pharma, Inc. Announce Phase 2 Results for VPD-737 in Patients With Chronic Pruritus 2Velocity Pharmaceutical Development, LLC and Tigercat Pharma, Inc. Announce Phase 2 Results for VPD-737 in Patients With Chronic Pruritus 3Velocity Pharmaceutical Development, LLC and Tigercat Pharma, Inc. Announce Phase 2 Results for VPD-737 in Patients With Chronic Pruritus 4AeroScout Founder Joins GlassesOff's Board of Directors 2AeroScout Founder Joins GlassesOff's Board of Directors 3Maryland-based Biotech Company's Path Forward in Treating Respiratory Diseases Sparks Name Change 2
... , , , , , , ... , 1Thermo Finnigan, Piscataway, NJ; , ... , Chemical Structure Validation , ... of ion trap mass spectrometers , , ...
... , , , , , , David Barnidge ... , Neuromics, Inc., Minneapolis, MN , ... , ICAT Analysis , , , ... ProteomeX integrated proteomics workstation., , , , , , ...
... , , , , , ... Center for Neurologic Diseases, Brigham and Womens Hospital, Harvard , ... , , , Genetic manipulations using neuronal cells ... RNA (siRNA) , to primary neuronal cultures is of critical ...
Cached Biology Technology:Analyzing Trace-Level Impurities of a Pharmaceutical Intermediate Using , an LCQ Deca Ion Trap Mass Spectrometer and the Mass Frontier , Software Package 2Analyzing Trace-Level Impurities of a Pharmaceutical Intermediate Using , an LCQ Deca Ion Trap Mass Spectrometer and the Mass Frontier , Software Package 3Analyzing Trace-Level Impurities of a Pharmaceutical Intermediate Using , an LCQ Deca Ion Trap Mass Spectrometer and the Mass Frontier , Software Package 4Analyzing Trace-Level Impurities of a Pharmaceutical Intermediate Using , an LCQ Deca Ion Trap Mass Spectrometer and the Mass Frontier , Software Package 5Analyzing Trace-Level Impurities of a Pharmaceutical Intermediate Using , an LCQ Deca Ion Trap Mass Spectrometer and the Mass Frontier , Software Package 6Analyzing Trace-Level Impurities of a Pharmaceutical Intermediate Using , an LCQ Deca Ion Trap Mass Spectrometer and the Mass Frontier , Software Package 7Analyzing Trace-Level Impurities of a Pharmaceutical Intermediate Using , an LCQ Deca Ion Trap Mass Spectrometer and the Mass Frontier , Software Package 8Analyzing Trace-Level Impurities of a Pharmaceutical Intermediate Using , an LCQ Deca Ion Trap Mass Spectrometer and the Mass Frontier , Software Package 9Quantification of the Purinergic Receptor P2X3 using ICAT and , Orthogonal 2D LC-MS/MS with an Ion Trap Mass Spectrometer 2Quantification of the Purinergic Receptor P2X3 using ICAT and , Orthogonal 2D LC-MS/MS with an Ion Trap Mass Spectrometer 3Quantification of the Purinergic Receptor P2X3 using ICAT and , Orthogonal 2D LC-MS/MS with an Ion Trap Mass Spectrometer 4Quantification of the Purinergic Receptor P2X3 using ICAT and , Orthogonal 2D LC-MS/MS with an Ion Trap Mass Spectrometer 5Quantification of the Purinergic Receptor P2X3 using ICAT and , Orthogonal 2D LC-MS/MS with an Ion Trap Mass Spectrometer 6Quantification of the Purinergic Receptor P2X3 using ICAT and , Orthogonal 2D LC-MS/MS with an Ion Trap Mass Spectrometer 7Efficient RNAi-mediated gene silencing in neuronal cells using QIAGEN , siRNA and TransMessenger Transfection Reagent* 2Efficient RNAi-mediated gene silencing in neuronal cells using QIAGEN , siRNA and TransMessenger Transfection Reagent* 3Efficient RNAi-mediated gene silencing in neuronal cells using QIAGEN , siRNA and TransMessenger Transfection Reagent* 4Efficient RNAi-mediated gene silencing in neuronal cells using QIAGEN , siRNA and TransMessenger Transfection Reagent* 5
(Date:12/17/2014)... 16, 2014 Valencell, a leader in performance ... technology to industry leaders such as Intel, Jabra, Atlas, ... biometric wearable products. These products will be showcased at ... Las Vegas . "Our partners ... and robust – with the clinical data to back ...
(Date:12/11/2014)... --Research and Markets , ... ) has announced the addition of the ... their offering. One major trend ... multimodal biometric systems. Multimodal biometric systems utilize more ... and identification purposes. This helps to reduce the ...
(Date:12/10/2014)... , Dec. 9, 2014  Wake Forest Baptist Medical ... building for its School of Medicine. Funding for this ... capital campaign that will be publicly launched next summer. ... located in the former 60 series R.J. Reynolds Tobacco ... Quarter. Construction will begin immediately with plans to be ...
Breaking Biology News(10 mins):Valencell PerformTek Biometrics Power the Most Accurate Wearables at CES 2015 2Biometrics Market in India 2015-2019: Key Vendors are 3M Cogent, NEC, Safran and Suprema 2Wake Forest Baptist to Build New Medical Education Facility In Wake Forest Innovation Quarter 2Wake Forest Baptist to Build New Medical Education Facility In Wake Forest Innovation Quarter 3Wake Forest Baptist to Build New Medical Education Facility In Wake Forest Innovation Quarter 4
... conducted by researchers at The University of Texas School ... abuse and dependence among Hispanic male populations in the ... along the U.S.-Mexico border. The expansion is supported ... on Alcohol Abuse and Alcoholism of the National Institutes ...
... book Artificial Gravity , edited by Gilles Clment and ... from the International Academy of Astronautics. This award is given ... the Academy in the fields related to life science. The ... on 28 September 2008 in Glasgow, Scotland. Artificial ...
... 2008) Just three years after it was discovered, a ... the Wildlife Conservation Society, which recently published the first-ever census ... the large, forest-dwelling primate hovers at 1,117 individuals, according to ... Oryx . The population estimate was the ...
Cached Biology News:Survey of Hispanics and alcohol dependence 2
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... against a partial recombinant FES. ... ~ 250 a.a) partial recombinant protein with ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... AAH35357 OMIM: ...
... raised against a partial recombinant ... PPP4C (NP_002711, 218 a.a. ... protein with GST tag. ... NM_002720 Protein ...
Mouse monoclonal antibody raised against a partial recombinant CAPG. NCBI Entrez Gene ID = CAPG...
Biology Products: