Navigation Links
Islet Sciences, Inc. Technologies Featured in Five Separate Presentations at the American Diabetes Association Annual Meeting
Date:6/24/2013

p>The technologies presented at the ADA meeting have received grant support from Department of Defense, National Institute of Health, Juvenile Diabetes Research Foundation, as well as funding from Islet Sciences. 

About Islet Sciences, Inc.


Islet Sciences is a development-stage biotechnology company with patented technologies focused on infusion therapy for people with insulin-dependent diabetes.  The Company's infusion technology includes methods for the culturing, isolation, maturation, and immunoprotection (microencapsulation) of islet cells. The Company's mission includes the introduction of commercial products relevant to the insulin dependent diabetes marketplace including diagnostics and anti-inflammatory compounds. For more information: www.isletsciences.com

Forward-Looking Statements


This press release contains forward-looking statements within the meaning of the Private Securities Litigation Reform Act of 1995.  Forward-looking statements for Islet Sciences reflect current expectations, as of the date of this press release, and involve certain risks and uncertainties.   Actual results could differ materially from those anticipated in these forward- looking statements as a result of various factors.  Factors that could cause future results to materially differ from the recent results or those projected in forward-looking statements include the risks described in the Islet Science's reports filed with the Securities and Exchange Commission.  The companies' further development is highly dependent on future medical and research developments and market acceptance, which is outside their control.

Investor Contact:
Jeff Ramson

ProActive Capital Group
646-863-6341
jramson@proactivecapital.com

Media Contact:
Sandra Lee
ProA
'/>"/>

SOURCE Islet Sciences, Inc.
Copyright©2012 PR Newswire.
All rights reserved

Page: 1 2 3

Related biology technology :

1. Islet Sciences Announces Exclusive License Agreement with the University of California (UCLA) to Commercialize Small Molecules for Islet Expansion
2. Islet Sciences Announces Exclusive License Agreement with Winthrop University Hospital to Commercialize a Beta Cell Loss Measurement Technology in Diabetes
3. Islet Sciences Names Richard A. Franco, Sr. to its Board of Directors
4. Islet Sciences Announces Receipt of $2.1 Million in Grant Support of Technology
5. Islet Sciences Announces DiaKine Therapeutics Novel Diabetes, Atherosclerosis Drugs Receives European Patent Protection
6. Islet Sciences, Inc. Selects NeoStems Manufacturing Subsidiary Progenitor Cell Therapy for Product Manufacturing
7. Pressure BioSciences, Inc. Closes Final Tranche of Series J Above Market Private Placement - Total Amount Raised in PIPE Slightly Exceeds $2 Million Goal
8. Pressure BioSciences, Inc. to Discuss First Quarter 2013 Financial Results and Provide Business Update
9. MedeAnalytics Ken Perez Predicts Rapid Growth of Healthcare Data Analytics Market at Conference on Data Analytics in Life Sciences, Healthcare and Biotech Companies
10. Regado Biosciences, Inc. Files Registration Statement for Proposed Initial Public Offering
11. VG Life Sciences, Inc. Secures Two-Year Funding Commitment and Administrative Support from MedBridge, LLC
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:11/22/2014)... , November 21, 2014 ... wechselt als Chief Commercial Officer zu KLOX    ... der Unternehmensentwicklung und Chief Financial Officer bestellt    ... mit der Vermarktung seines jüngst zugelassenen Behandlungssystems zur Wundheilung ... ("KLOX" bzw. das "Unternehmen") ist sehr erfreut, die folgenden ...
(Date:11/21/2014)... 20, 2014 Offering a complete line ... Entris Balance promotion . The Sartorius Entris Balance is ... high accuracy, and easy-to-maintain balance entry level balance. , ... was designed to help customer’s bridge the gap between ... that is very durable. Sartorius is the second biggest ...
(Date:11/21/2014)... NY (PRWEB) November 20, 2014 The ... now available as an open access journal featuring the ... infrared fluorescent proteins to preserve photoresponsiveness in the retina ... Two-color fluorescent in situ hybridization using chromogenic substrates in ... for DNA, RNA, and protein electrophoresis , ...
(Date:11/21/2014)... 2014 2014 Deep Research Report ... in-depth research report on the transformer market. The ... application, and industry chain structure as well as ... analysis, including China’s domestic market as well as ... situation analysis. The report also covers information on ...
Breaking Biology Technology:KLOX Technologies meldet Neubesetzung von Führungspositionen 2KLOX Technologies meldet Neubesetzung von Führungspositionen 3KLOX Technologies meldet Neubesetzung von Führungspositionen 4KLOX Technologies meldet Neubesetzung von Führungspositionen 5Pipette.com Announces an Extension on the Sartorius Entris Balance Promotion to the End of 2014 2BioTechniques: The International Journal of Life Science Methods Announces the Publication of the November 2014 Issue—Available in Print and Online 2BioTechniques: The International Journal of Life Science Methods Announces the Publication of the November 2014 Issue—Available in Print and Online 3International Transformer Industry - Analysis on Applications, Development & Forecasts Now Available at ReportsnReports.com 2International Transformer Industry - Analysis on Applications, Development & Forecasts Now Available at ReportsnReports.com 3
... /PRNewswire-FirstCall/ - MIGENIX Inc.,(TSX: MGI; OTC: MGIFF), ... reports financial results for the three months ... its programs., UPDATE ON DRUG DEVELOPMENT ... cationic peptide;,prevention of catheter-related infections): A pivotal ...
... a Planned Phase II Study of ... Sclerosis, COPENHAGEN, Denmark, December 13 Genmab A/S,(OMX: ... study of,ofatumumab (HuMax-CD20(R)) for the treatment of relapsing remitting,multiple ... study which will be conducted under Genmab,s collaboration with,GlaxoSmithKline ...
... SAN FRANCISCO, Calif., Dec. 13 Anesiva,Inc. (Nasdaq: ... a common stock offering,of 11,111,111 shares of its ... discount to the closing bid price on December ... before deducting underwriting,discounts and commissions (approximately $50 million ...
Cached Biology Technology:MIGENIX Reports Second Quarter Fiscal Year 2008 Financial Results 2MIGENIX Reports Second Quarter Fiscal Year 2008 Financial Results 3MIGENIX Reports Second Quarter Fiscal Year 2008 Financial Results 4MIGENIX Reports Second Quarter Fiscal Year 2008 Financial Results 5MIGENIX Reports Second Quarter Fiscal Year 2008 Financial Results 6MIGENIX Reports Second Quarter Fiscal Year 2008 Financial Results 7MIGENIX Reports Second Quarter Fiscal Year 2008 Financial Results 8MIGENIX Reports Second Quarter Fiscal Year 2008 Financial Results 9MIGENIX Reports Second Quarter Fiscal Year 2008 Financial Results 10MIGENIX Reports Second Quarter Fiscal Year 2008 Financial Results 11MIGENIX Reports Second Quarter Fiscal Year 2008 Financial Results 12MIGENIX Reports Second Quarter Fiscal Year 2008 Financial Results 13MIGENIX Reports Second Quarter Fiscal Year 2008 Financial Results 14MIGENIX Reports Second Quarter Fiscal Year 2008 Financial Results 15MIGENIX Reports Second Quarter Fiscal Year 2008 Financial Results 16MIGENIX Reports Second Quarter Fiscal Year 2008 Financial Results 17MIGENIX Reports Second Quarter Fiscal Year 2008 Financial Results 18Genmab Announces Details of Planned Ofatumumab Phase II Study in Multiple Sclerosis 2Genmab Announces Details of Planned Ofatumumab Phase II Study in Multiple Sclerosis 3Anesiva Raises $45 Million in Common Stock Offering 2
(Date:11/6/2014)... 6, 2014 - Insilico Medicine, Inc, a Baltimore-based ... age related diseases announced a research collaboration with ... Champions Oncology, Inc (OTC: CSBR). , "There are ... medicine, but Champions Oncology,s TumorGraft technology is unique ... chemotherapy regimen experimentally generating vast amounts of valuable ...
(Date:11/5/2014)... Kelly Redmond has dedicated his career to understanding ... a general audience. , As deputy director and ... at Nevada,s Desert Research Institute, Redmond has more ... application and dissemination of climate data to the ... Meeting in San Francisco on December 15-19, 2014 ...
(Date:11/4/2014)... LAKE CITY, Nov. 5, 2014 – University of Utah ... enzymes to help jet fuel produce electricity without needing ... be used to power portable electronics, off-grid power and ... online today in the American Chemical Society journal ... electricity through a chemical reaction between a fuel and ...
Breaking Biology News(10 mins):Insilico Medicine, Inc announces research collaboration with Champions Oncology, Inc 2Nevada climatologist to be honored at AGU Fall Meeting for lifetime of public outreach 2Jet-fueled electricity at room temperature 2
... for the first time, how a potted plant,s roots are arranged ... be presented at the Society for Experimental Biology meeting on 30th ... makes plants grow over 40% larger. From their 3-D ... their roots to the pot,s walls. It is likely that the ...
... new batch of Geology papers posted online ... asynchrony; oceanic crust; sand budgets; the Alpine fault,s seismic ... weathering in the Critical Zone; giant wave ripples; the ... network; and soils as ledgers recording transactions of energy ...
... apart DNA that bears certain signature sequences is a defense ... can be a powerful research tool. With a newly discovered ... a targeted method of slicing DNA that they say can ... lab. Tools that snip apart DNA strands in defined ...
Cached Biology News:Sandy beaches, hydrocarbon reservoirs, tectonic tilting: It's all about geology 2Sandy beaches, hydrocarbon reservoirs, tectonic tilting: It's all about geology 3Sandy beaches, hydrocarbon reservoirs, tectonic tilting: It's all about geology 4Sandy beaches, hydrocarbon reservoirs, tectonic tilting: It's all about geology 5Sandy beaches, hydrocarbon reservoirs, tectonic tilting: It's all about geology 6Sandy beaches, hydrocarbon reservoirs, tectonic tilting: It's all about geology 7Sandy beaches, hydrocarbon reservoirs, tectonic tilting: It's all about geology 8Sandy beaches, hydrocarbon reservoirs, tectonic tilting: It's all about geology 9Sandy beaches, hydrocarbon reservoirs, tectonic tilting: It's all about geology 10Programmable RNA complex could speed genome editing in the lab 2Programmable RNA complex could speed genome editing in the lab 3
... a partial recombinant FES. ... 250 a.a) partial recombinant protein with GST ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: BC035357 ... AAH35357 OMIM: 190030, ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
... sufficient materials for 1,464 array sample elements. , , ... , Blocker BSA in PBS (10X): 50 ml ... BupH Phosphate Buffered Saline: 8 packs , 10% ... Pico Luminol Enhancer: 2 x 25 ml , SuperSignal ...
Biology Products: