Navigation Links
Ion Semiconductor Sequencing Data Presentations at AGBT Demonstrate More than >1,000-fold Throughput Scaling in First Two Years on the Market
Date:2/22/2013

s of historical fact are forward-looking statements. When used, the words "believe," "plan," "intend," "anticipate," "target," "estimate," "expect" and the like, and/or future tense or conditional constructions ("will," "may," "could," "should," etc.), or similar expressions, identify certain of these forward-looking statements. Important factors which could cause actual results to differ materially from those in the forward-looking statements are detailed in filings made by Life Technologies with the Securities and Exchange Commission. Life Technologies undertakes no obligation to update or revise any such forward-looking statements to reflect subsequent events or circumstances.

(Logo: http://photos.prnewswire.com/prnh/20110216/MM49339LOGO)

Life Technologies Contact
Wes Conard
650-243-6019
wes.conard@lifetech.com


'/>"/>
SOURCE Life Technologies
Copyright©2012 PR Newswire.
All rights reserved

Page: 1 2 3

Related biology technology :

1. Researchers create semiconductor nano-shish-kebabs with potential for 3-D technologies
2. Innovative semiconductor device researcher at NJIT to receive professional award
3. New semiconductor research may extend integrated circuit battery life tenfold
4. Tiny compound semiconductor transistor could challenge silicons dominance
5. Research discovery could revolutionize semiconductor manufacture
6. U of Toronto-led team induces high-temperature superconductivity in a semiconductor with Scotch tape
7. Semiconductors grown on graphene
8. New Torrent Suite Software Provides Highest Accuracy and 400 Base Pair Kits Deliver Broader Applications for Ion Semiconductor Sequencing
9. Worlds smallest semiconductor laser created by University of Texas scientists
10. Life Technologies to Accelerate Development of Ion Torrent Semiconductor Technology for Proteomic Applications in Research, Applied and Clinical Markets
11. Cooling semiconductor by laser light
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:6/19/2013)... Today DuPont Executive Vice President James C. Borel ... greatest challenge facing our time – ensuring food security ... at the International Food and Agribusiness Management Association ... students to contribute their time and talents to create ... collaboration with others. , “Food is one of the ...
(Date:6/19/2013)... India’s vast and growing population ... worth up to a billion dollars per year ... is taking serious action to better regulate and ... presentation will examine:, ,     Recent changes ... and long term impacts ,     Foreseeable opportunities ...
(Date:6/19/2013)... Adding to their already extensive supply ... Simport’s Dropette® and Heathrow Scientific disposable plastic ... basic biology, chemistry and any type of liquid handling ... 35 years, Simport has been supplying the science community ... the Simport Dropette®. Simport’s Dropette® is a one-piece ...
(Date:6/18/2013)... New York, NY (PRWEB) June 18, 2013 ... technological innovation and sustainability, the Consulate General of Switzerland ... largest solar boat, Switzerland’s MS Tûranor PlanetSolar , ... as part of its DeepWater Expedition 2013 tour with ... catamaran, led by Capitain Gérard d’Aboville, runs exclusively on ...
Breaking Biology Technology:DuPont Leader Calls for New Generation of Food Visionaries to Fight Hunger 2Leading Pipette Distributor Pipette.com Now Stocks Transfer Pipettes: Simport’s Dropette and Heathrow Scientific Disposable Plastic Transfer Pipettes 2Switzerland’s MS Tûranor PlanetSolar, the World’s Largest Solar Boat, Arrives in New York City 2Switzerland’s MS Tûranor PlanetSolar, the World’s Largest Solar Boat, Arrives in New York City 3Switzerland’s MS Tûranor PlanetSolar, the World’s Largest Solar Boat, Arrives in New York City 4
... MOUNTAIN VIEW, Calif., Jan. 17, 2012  MAP Pharmaceuticals, Inc. (Nasdaq: ... James O,Shea to its Board of Directors. Mr. O,Shea brings ... product commercialization and operations. "We are privileged to ... time in the Company,s development as we focus our efforts ...
... 16, 2012 Luminex Corporation (Nasdaq: LMNX ) ... fourth quarter and full year 2011 on Monday, February 6, ... release after the close of trading. (Logo: ... conference call to discuss the operating highlights and financial results ...
... 2012 Elsevier, a world-leading provider ... services, announced today that its first bilingual platform of ... , is now available online. NursingChina ... available in China, featuring skills within specialties such ...
Cached Biology Technology:MAP Pharmaceuticals Appoints W. James O'Shea to Board of Directors 2MAP Pharmaceuticals Appoints W. James O'Shea to Board of Directors 3Luminex Corporation Fourth Quarter and Full Year 2011 Earnings Release Scheduled for February 6, 2012 2Luminex Corporation Fourth Quarter and Full Year 2011 Earnings Release Scheduled for February 6, 2012 3Elsevier Launches Bilingual International Nursing Skill Training and Management Platform: NursingChina.com 2Elsevier Launches Bilingual International Nursing Skill Training and Management Platform: NursingChina.com 3
(Date:6/19/2013)... journal Polar Biology, researchers report using DNA from tissues samples ... type of killer whale ( Orcinus orca ). ... on a New Zealand beach and a skeleton was saved ... it was almost 50 years before this unique form of ... bulbous forehead, was documented alive in the wild. , ...
(Date:6/19/2013)... Insulin is the most potent physiological anabolic ... storage and synthesis of lipids, protein and carbohydrates, ... circulatory system. It also plays a major role ... the glucose is metabolized and removed from the ... the precise molecular mechanisms by which insulin regulates ...
(Date:6/19/2013)... are expected to contribute to a very large and ... to a University of Michigan ecologist and colleagues who ... the Chesapeake Bay. , The Gulf forecast, one of ... calls for an oxygen-depleted, or hypoxic, region of between ... among the 10 largest on record. , The low ...
Breaking Biology News(10 mins):Breakthrough research of essential molecule reveals important targets in diabetes and obesity 2U-M researcher and colleagues predict possible record-setting Gulf of Mexico 'dead zone' 2U-M researcher and colleagues predict possible record-setting Gulf of Mexico 'dead zone' 3U-M researcher and colleagues predict possible record-setting Gulf of Mexico 'dead zone' 4
... in biomedical science are on the horizon with ... Infrastructure (Instruct) in support of European biomedical research. ... (ESFRI) is involved in establishing about 40 such ... is one such biomedical project, whose aim is ...
... center responsible for responding goes into gear, setting off a ... from the adrenal glands. Dr. Gil Levkowitz ... now revealed a new kind of ON-OFF switch in the ... from the brain that stimulates cortisol release in the body. ...
... by a University of California, Davis, plant scientist delivers a ... world-renowned wine industry. The study is set for publication ... the Proceedings of the National Academy of Sciences. "Many ... plant, but we believe that most microbes would have difficulty ...
Cached Biology News:European Integrated Structural Biology Infrastructure launching 2A unique on-off switch for hormone production 2Fused genes tackle deadly Pierce's disease in grapevines 2
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Mouse monoclonal antibody raised against a full length recombinant GPT. NCBI Entrez Gene ID = GPT...
Rabbit polyclonal antibody to GluR2...
Biology Products: