Navigation Links
Global Molecular Biology Enzymes, Kits, & Reagents (Cloning, Epigenetics, PCR, Restriction Digestion, Sequencing) Market - Forecast to 2018
Date:8/22/2014

DUBLIN, Aug. 22, 2014 /PRNewswire/ -- Research and Markets has announced the addition of the "Global Molecular Biology Enzymes, Kits, & Reagents (Cloning, Epigenetics, PCR, Restriction Digestion, Sequencing) Market - Forecast to 2018" report to their offering.

The global molecular biology enzymes market was valued at $2,847.63 million in 2013, and is expected to grow at a CAGR of 13.74% to reach $5,420.63 million in 2018. Molecular biology enzymes, kits, & reagents find applications in a large number of fields in life science research. They also find application in diagnostics and drug discovery research. These products are widely used for analysis of cell surface markers, which can act as diagnostics or therapeutic targets. PCR (polymerase chain reactions) is one of the most widely-used analytical and preparative techniques in molecular biology. It finds applications in large numbers of experimental procedures, like preparative PCR, RT-PCR, qPCR, and so on. As such, it is one of the largest application segments of the molecular biology enzymes market in 2013. PCR also finds applications in diagnostics, gene expression, and DNA fingerprinting.

This report provides a granular understanding of the molecular biology enzymes, kits & reagents market. This report segments the global molecular market on the basis of applications, end users, products and geographies. The application segments included in this report are cloning, epigenetics, PCR, restriction digestion, sequencing, and other applications. The end-user segments of this market are academic research institutes, hospitals and diagnostic centers, pharmaceutical and biotech companies, and other end users.

The product segments included in this report are enzymes, kits and reagents. The enz
'/>"/>

SOURCE Research and Markets
Copyright©2014 PR Newswire.
All rights reserved

Page: 1 2 3

Related biology technology :

1. Global Hormone Replacement Therapy Market 2014-2018: Key Vendors are Actavis, Bayer, Merck & Co, Novartis and Novo Nordisk
2. Clintrax Global, Inc. Announces Addition to Executive Team
3. Global Cell and Tissue Culture Supplies - Strategic Business Report 2014
4. Global Solid Oxide Fuel Cells (SOFCs) - Strategic Business Report 2014
5. Global Spectroscopy Equipment and Accessories - Strategic Business Report 2014
6. Linalool Industry & Diphenylamine Market (Global, China) 2014 Analysis Now Available at DeepResearchReports.com
7. Global HIV Infection Drug Market Overview
8. Global Life Science Reagents Market Expected to Reach USD 25.7 Billion in 2019: Transparency Market Research
9. Hospira to Present at the Morgan Stanley Global Healthcare Conference
10. Global non-GMO Food Market 2014-2018: Key Vendors are Amys Kitchen, Natures Path, Organic Valley and The Hain Celestial
11. Savory Ingredients Market by Ingredients (Yeast Extracts, HVP, HAP, MSG, Nucleotides and Others), by Application (Food Industry, Pet Food and Others) & by Geography - Global Trends & Forecasts to 2019
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:11/24/2014)... Dallas, Texas (PRWEB) November 24, 2014 ... China Adipic Dihydrazide Industry is a professional and ... It provides Adipic Dihydrazide information, like its definition, ... as industry overview. This report covers the international ... as global (such as the US, Europe, Asia, ...
(Date:11/22/2014)... Audubon, PA and London (PRWEB) November 21, 2014 ... in December will explore what comes next for ALS research ... clinical sites. , After the Ice Bucket Challenge: Where ... Merit Cudkowicz, Date: Tuesday, 2 December 2014, Time: ... complimentary , Join expert speaker Dr. Merit Cudkowicz, Julianne ...
(Date:11/22/2014)... 21, 2014 On November 17th Chicago ... 2014 Emerging Medical Technologies Summit in San Francisco to ... Widely regarded among Silicon Valley investors and technology elites ... the win also positions Briteseed to move on ... in 2015 and compete with other elite innovation finalists ...
(Date:11/21/2014)... Quebec , November 21, 2014 ... como responsable comercial   Mariano Rodríguez es ...   KLOX está en marcha para comenzar ... de cura de heridas de reciente aprobación en Europa   ... "la compañía") se complace al anunciar los siguientes nombramientos: ...
Breaking Biology Technology:Adipic Dihydrazide Industry 2019 Research Forecasts on Worldwide, China Regions Now Available at ReportsnReports.com 2Adipic Dihydrazide Industry 2019 Research Forecasts on Worldwide, China Regions Now Available at ReportsnReports.com 3DrugDev Webinars in December to Explore What Comes Next for ALS Research and How We Can Make Life Easier for Clinical Sites 2Insight Product Development Accelerator Member Wins MedTech Innovator Award Competition 2Insight Product Development Accelerator Member Wins MedTech Innovator Award Competition 3KLOX Technologies anuncia sus nombramientos ejecutivos 2KLOX Technologies anuncia sus nombramientos ejecutivos 3KLOX Technologies anuncia sus nombramientos ejecutivos 4KLOX Technologies anuncia sus nombramientos ejecutivos 5
... Laura G. Leff, Department of Biological Sciences, Kent State,University, Kent, Ohio , ... Introduction , Assessing bacterial genetic ... because of difficulties in culturing native bacteria and the large number , ... physiological , traits of most microbes are ...
... and Li Tian, PhD, Bio-Rad Laboratories, 2000 Alfred,Nobel Drive, Hercules, CA 94547 USA, ... The Benchmark Plus microplate reader is a new ... that offers superior convenience, accuracy, and flexibility. , ... , feature has been designed in Microplate ...
, , , , , , back to top...
Cached Biology Technology:Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 2Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 3Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 4Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 5Benchmark Plus Microplate Reader Scan Well Feature 2Benchmark Plus Microplate Reader Scan Well Feature 3
(Date:11/4/2014)... about the way our bodies are assembled during early ... they are supposed to become a nerve or a ... correct place and alignment? Researchers at the University of ... a new study, UM researchers describe the signaling systems ... at the head-trunk region. Their discovery may have important ...
(Date:11/4/2014)... , November 4, 2014   ... market growth   Fuel3D , a developer ... a funding round totaling $6.4 million (£4 million). This funding ... secured earlier this year and paves the way for the ... The funding round was led by Chimera Partners ...
(Date:11/4/2014)... , Nov. 4, 2014   Neurotechnology ... today announced that the latest version of its ... the Ongoing MINEX evaluation organized by ... fingerprint algorithms using the INCITS 378 fingerprint standard ... requirement in public tenders in the ...
Breaking Biology News(10 mins):The inside story: How the brain and skull stay together 2Fuel3D Secures $6.4 Million in Expansion Funding 2Fuel3D Secures $6.4 Million in Expansion Funding 3Neurotechnology Places Second in Ongoing MINEX Ranking for Fingerprint Matching Algorithms 2Neurotechnology Places Second in Ongoing MINEX Ranking for Fingerprint Matching Algorithms 3
... 9, 2009 Even small errors made by cells during protein ... ways to uncover these mistakes and correct them. Though in ... alaninenature has been extra careful, developing not one, but two ... is used correctly. Now, scientists at The Scripps ...
... to celebrate New Year,s Eve, drug industry executives will likely ... companies who make top-selling drugs for heart disease, asthma, and ... of mounting market pressures and a global recession. A timely ... scheduled for the current issue of Chemical & Engineering ...
... The University of Alabama used worms to reel in information ... cellular mechanisms that may be exploited to treat epilepsy. In ... ( http://www.genetics.org ), the researchers explain how the transparent roundworm, ... that control the transport of a molecule (gamma-aminobutyric acid or ...
Cached Biology News:Scripps Research team uncovers chemical basis for extra 'quality control' in protein production 2Scripps Research team uncovers chemical basis for extra 'quality control' in protein production 3Scripps Research team uncovers chemical basis for extra 'quality control' in protein production 4More than fish bait: Worms unlock secrets to new epilepsy treatments 2
... Staining Solution stains proteins in polyacrylamide ... limit >= 8 ng of protein) ... and destaining processes can be performed ... gel (20 min), proteins can be ...
Mouse monoclonal antibody raised against a partial recombinant PASK. NCBI Entrez Gene ID = PASK...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... antibody raised against a partial recombinant FES. ... 120 a.a. ~ 250 a.a) partial recombinant ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Accession Number: AAH35357 ...
Biology Products: