Navigation Links
GenomeQuest Places ChIP-Seq Workflow Solution On SDM “Cloud”
Date:11/11/2009

Comprehensive, Easy-to-Use Web Service Available Immediately to Researchers Worldwide, Free/Full NGS-based Runs Available to First Registrants

Westborough, MA (PRWEB) -- GenomeQuest, the world leader in sequence data management (SDM), today announced a comprehensive and easy-to-use ChIP-Seq workflow solution available immediately as a web cloud service to researchers around the world.

The ChIP-Seq method is described in this month’s Nature Methods journal, “Genome-wide measurements of protein-DNA interactions and transcriptomes are increasingly done by deep DNA sequencing methods (ChIP-Seq and RNA-Seq).” Reporting on tools, it continues, “Whereas early adopters necessarily developed their own custom computer code to analyze the first ChIP-Seq and RNA-Seq datasets, a new generation of more sophisticated algorithms and software tools are emerging to assist in the analysis phase of these projects.”

Based on the company’s SDM platform and integrating the popular Model based Analysis for ChIP-Seq “MACS” peak modeling software, the GenomeQuest ChIP-Seq solution provides state-of-the-art tools across the entire workflow, including for alignment, peak modeling, and interactive analysis. To maximize accuracy, it allows for over 15 key parameters to be set and multiple runs to be stacked and analyzed collectively. Also, researchers can immediately share and connect their results with other sequence databases, GenomeQuest workflows, and colleagues – preserving and leveraging their work.

This full workflow is delivered in an easy-to-use, integrated environment. From a web browser, researchers simply upload their database and fill out two forms – one each for alignment and peak
'/>"/>

Source: PRWeb
Copyright©2009 Vocus, Inc.
All rights reserved  

Page: 1 2 3 4

Related biology technology :

1. GenomeQuest, Inc. Announces Digital Gene Expression Solution Within Its Sequence Data Management Platform
2. SABiosciences Ranked 17th on the Best Places to Work Industry Award for Biotech and Pharmaceutical Companies
3. DuPont Named Among Best Places to Work by The Scientist Magazine
4. AMERIGROUP Corporation Named One of Best Places to Work in Healthcare
5. Environmental Tectonics Corporations BioMedical Systems Division Places Two Monoplace Chambers at East Orange (NJ) General Hospital
6. Fujirebio Diagnostics Named One of the Best Places to Work in Pennsylvania
7. Quintiles Named to Computerworld Magazines 100 Best Places to Work in Information Technology List
8. Abbott Named One of the Best Places to Launch a Career by BusinessWeek
9. Health Robotics Announces December Launch of the i.v.SOFT(TM) Workflow Engine at ASHP in Las Vegas
10. MEDRAD Partners with the University of South Florida and Moffitt Cancer Center to Study Workflow and Process Improvements in PET Imaging
11. Bio-Optronics Adds Innovative Electronic Data Capture (EDC) Solution to Clinical Conductor Clinical Trial Management System (CTMS), Continues to Improve Workflow and Productivity
Post Your Comments:
*Name:
*Comment:
*Email:
Related Image:
GenomeQuest Places ChIP-Seq Workflow Solution On SDM “Cloud”
(Date:11/22/2014)... 21, 2014   ... Commercial Officer zu KLOX    ... Chief Financial Officer bestellt    KLOX ... seines jüngst zugelassenen Behandlungssystems zur Wundheilung zu beginnen    ... "Unternehmen") ist sehr erfreut, die folgenden personellen Veränderungen anzukündigen: ...
(Date:11/21/2014)... BELLINGHAM, Washington, USA (PRWEB) November 19, 2014 ... used in our lives was shared with more than ... undergraduate and postgraduate students from the University of Otago ... Outreach Grant . The Otago students, members of the ... Southland New Zealand in early September, giving children from ...
(Date:11/21/2014)... 20, 2014 The California ... research organization representing leading California academic institutions, biotechnology, ... PwC US today released a report revealing ... industry growth. The trend shows a 4 percent ... California Biomedical Industry Report indicates that, while ...
(Date:11/21/2014)... Fayetteville, Arkansas (PRWEB) November 20, 2014 ... partners, Pinnacle Ozone Solutions, LLC (Pinnacle), and PCI, ... equipment, announced that they have been selected to ... City of Fayetteville, Arkansas Paul R. Noland Wastewater ... feature BlueInGreen’s patented HyDOZ® gas dissolution ...
Breaking Biology Technology:KLOX Technologies meldet Neubesetzung von Führungspositionen 2KLOX Technologies meldet Neubesetzung von Führungspositionen 3KLOX Technologies meldet Neubesetzung von Führungspositionen 4KLOX Technologies meldet Neubesetzung von Führungspositionen 5Optics and photonics outreach programs share science, spark fascination with light 2Optics and photonics outreach programs share science, spark fascination with light 3California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 2California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 3California Healthcare Institute and PwC Report Boom in California’s Biomedical Industry 4City of Fayetteville Leads Nation with Innovative Ozone Technology 2City of Fayetteville Leads Nation with Innovative Ozone Technology 3City of Fayetteville Leads Nation with Innovative Ozone Technology 4
... veteran, was promoted to president of the General Electric Medical ... who left to become CEO at Invitrogen. The division focuses ... systems . , ,It's a dream job for a corporate ... about $9 billion and produced GE CEO and Chairman Jeffery ...
... develops and sells employee scheduling and management products. The ... and co-founder of Suite Scheduler, a former nurse manager ... employees in a facility. , ,Suite Scheduler products are ... up to 90% of the time to create and ...
... That is, until he gets to the better drugs, faster ... the science behind the Madison-based companys products is likely to ... nears the age when diseases and treatments become as common ... the two and a half-year-old company that Vodenlich joined as ...
Cached Biology Technology:CEO Wilson Defines GE's Health-IT Customer 2CEO Wilson Defines GE's Health-IT Customer 3CEO Wilson Defines GE's Health-IT Customer 4Scheduling made easy with Suite Scheduler 2Scheduling made easy with Suite Scheduler 3Chipping Away at Drug Development 2Chipping Away at Drug Development 3
(Date:11/18/2014)... , Nov. 18, 2014   EyeLock Inc. ... solutions, and MorphoTrust USA (Safran), a ... today announced a strategic partnership to offer comprehensive ... vehicle administration (MVA), airport screening and financial services ... solutions, MorphoTrust serves consumers through a nationwide network ...
(Date:11/11/2014)... , Nov. 11, 2014  Forensicon, Inc., a ... firm, is pleased to announce the promotion of ... Director of Digital Forensics. In Schiff,s new role as ... the team of digital forensics examiners and provide leadership ... Photo - http://photos.prnewswire.com/prnh/20141110/157719 ...
(Date:11/7/2014)... Calif. , Nov. 7, 2014  In conjunction with ... Police Departments, The Community Foundation of the Verdugos ... DNA JUSTICE PROJECT," a $250,000 initiative to keep ... initial phase. In its first six months of existence, the ... needed evidence support for local law enforcement. "Because ...
Breaking Biology News(10 mins):EyeLock, MorphoTrust Form Strategic Partnership to Pursue Commercial Enterprise Deployments 2EyeLock, MorphoTrust Form Strategic Partnership to Pursue Commercial Enterprise Deployments 3Yaniv Schiff Promoted to Director of Digital Forensics at Forensicon, Inc. 2Community Foundation Of The Verdugos Unveils Campaign To Fund Glendale-Burbank DNA Justice Project 2
... February 26, 2013, New York, N.Y. and San Diego, Calif. ... tumor in adults, is challenging to treat because the tumors ... more about the causes of tumor cell growth and drug ... new targeted therapies to potentially treat this deadly cancer. ...
... 2013, Reston, VAResearchers will meet at the Society of ... a number of health concerns that have received growing ... of the presentations, scientists will explore how the development ... related exposures might affect the risk assessment of arsenic ...
... Rockville, Md. The Association for Research in Vision ... three keynote speakers, including two Nobel laureates, during the ... Wash. New this year, the ARVO/Alcon Keynote Series ... Christopher Murray, MD, DPhil. Smithies, of the University ...
Cached Biology News:Novel combination therapy shuts down escape route, killing glioblastoma tumor cells 2Scientists explore topical health issues at meeting in Texas 23 distinguished keynote speakers to present during ARVO 2013 Annual Meeting 2
... a partial recombinant FES. ... 250 a.a) partial recombinant protein with GST ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: BC035357 ... AAH35357 OMIM: 190030, ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
... sufficient materials for 1,464 array sample elements. , , ... , Blocker BSA in PBS (10X): 50 ml ... BupH Phosphate Buffered Saline: 8 packs , 10% ... Pico Luminol Enhancer: 2 x 25 ml , SuperSignal ...
Biology Products: