Navigation Links
EU Committee Approves New Food Applications for Martek's life'sDHA(TM)
Date:7/17/2009

COLUMBIA, Md., July 17 /PRNewswire-FirstCall/ -- DHA omega-3 innovator and maker of the life'sDHA(TM) brand of DHA, Martek Biosciences (Nasdaq: MATK), announced today that it has received a unanimous positive vote from the Standing Committee On The Food Chain and Animal Health (SCFCAH) of the European Union for additional novel food approval of life'sDHA in Europe.

This is a significant action that will provide for new uses of Martek's DHA-rich algal oil in bakery products, cereal bars, and beverages, including milk-based and milk analogue drinks, throughout the 27 Member States of the European Union. This expands the current categories approved in 2003 which include breakfast cereals, spreadable fat and dressings, dairy products (excluding milk-based and milk analogue drinks) and food supplements.

There are currently more than 30 food, beverage and supplement products that include life'sDHA available in the EU.

"This additional novel food approval will allow Martek to work in even more food and beverage categories and offer European consumers the important benefits of DHA in healthy and convenient products with life'sDHA for brain, eye and heart health." said Rob Winwood, PhD, Martek's director of scientific affairs in Europe.

The July 15, 2009 draft Commission decision will now pass into the formal procedure before anticipated publication in the Official Journal of the European Union in the coming months.

DHA omega-3 is a long-chain omega-3 fatty acid that serves as a primary building block for the brain and the eyes and supports brain, eye and cardiovascular health throughout life. There is a large and growing body of scientific evidence demonstrating that people of all ages benefit from an adequa
'/>"/>

SOURCE Martek Biosciences Corporation
Copyright©2009 PR Newswire.
All rights reserved

Page: 1 2 3

Related biology technology :

1. Brazilian National Biosafety Technical Committee Approves Monsanto Company Insect-Protected Corn Trait
2. Ortho Biotech Supports FDA Advisory Committees Recommendations on Use of ESAs in Chronic Renal Failure Patients
3. Michigan Catholic Conference Responds to Formation of Embryonic Stem Cell Research Ballot Committee
4. Genzyme to Participate in FDA Advisory Committee Meeting on the Use of Phosphate Binders in Chronic Kidney Disease
5. Meredith Martin Addy Named Chair of AIPLAs Amicus Committee
6. California IVF Experts Tap Ethics Committee for Guidance
7. Ortho Biotech Modifies Prescribing Information for PROCRIT(R) (Epoetin alfa) Label Reflects Recommendations from Recent FDA Advisory Committee Meetings
8. California Stem Cell Board Member Violates Conflict Rules; Should Resign From Committee, Consumer Group Says
9. Lota Zoth Elected to Ikaria Board and Named Audit Committee Chair
10. GSK Receives Favorable Recommendation by FDA Advisory Committee for Rotarix(R) (Rotavirus Vaccine, Live, Oral)
11. New 300mg Loading Dose Tablet for Plavix(R) Receives Positive Opinion From the European Committee for Medicinal Products (CHMP)
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:9/19/2014)... YORK, September 18, 2014 Scientists at NYU Langone ... dramatically the efficiency of the process for turning adult ... well-known compounds, including vitamin C. Using the new technique ... cells obtained from adult skin cells by more than ... technique is efficient and reliable, and thus should generally ...
(Date:9/19/2014)... Sept. 19, 2014  Nektar Therapeutics (NASDAQ: ... studies characterizing the analgesic profiles of a series ... receptor agonist molecules. The preclinical research candidates were ... platform. The analgesic properties of kappa ... literature. 1,2 Kappa opioid receptors are expressed ...
(Date:9/19/2014)... -- Dublin ... the addition of the  "Micro Market Monitor : ...      (Logo: http://photos.prnewswire.com/prnh/20130307/600769) , , ,The ... segments in the chromatography market. The market was ... to reach $2.0 billion by 2019, at a ...
(Date:9/18/2014)... -- About POCT POCT, also ... laboratory. It helps in making fast clinical decisions, ... POCT is gaining popularity due to the increasing ... diabetes, heart disease, and obesity. It is generally ... minimize errors during the diagnosis of patients. POCT ...
Breaking Biology Technology:NYU Langone scientists report reliable and highly efficient method for making stem cells 2NYU Langone scientists report reliable and highly efficient method for making stem cells 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 2Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 4Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 5Micro Market Monitor : Global Pre-packed Chromatography Columns 2POCT Market in China 2014-2018 2
... Andrea Armani and Ellis Meng, Both from Viterbi ... at MIT in September , , LOS ... Southern California today announced that two faculty members from the USC ... magazine as some of the world,s top innovators under the ...
... , ... announced that its Oragene®•DNA product has been selected by Prometheus as the sample collection ... for this type of genetic testing service as it solves sample collection challenges inherent ... ...
... PRINCETON, N.J., Aug. 18 Laureate Pharma, Inc., a ... of Joel A. Tune as a new member of its Board ... http://www.newscom.com/cgi-bin/prnh/20080131/N E TH020LOGO ) , ... focused on Laureate,s contract manufacturing business, Mr. Tune brings to Laureate ...
Cached Biology Technology:Two University of Southern California Innovators Recognized by Technology Review's Prestigious TR35 Listing of the World's Top Young Innovators for 2009 2Two University of Southern California Innovators Recognized by Technology Review's Prestigious TR35 Listing of the World's Top Young Innovators for 2009 3Two University of Southern California Innovators Recognized by Technology Review's Prestigious TR35 Listing of the World's Top Young Innovators for 2009 4Two University of Southern California Innovators Recognized by Technology Review's Prestigious TR35 Listing of the World's Top Young Innovators for 2009 5DNA Genotek Sample Collection Kit Selected by Prometheus for MyCeliacID™ Genetic Test 2DNA Genotek Sample Collection Kit Selected by Prometheus for MyCeliacID™ Genetic Test 3Laureate Pharma Elects New Board Member 2
(Date:9/18/2014)... - Washington State University researchers have developed a unique ... power waste cleanup in rural areas. , The ... an inexpensive and quick way to clean up waste ... while reducing pollution. , Professor Haluk Beyenal and ... Engineering and Architecture discuss the system in the online ...
(Date:9/18/2014)... Colo., USA Miranda, a small, icy moon of ... enigmatic bodies in the solar system. Despite its relatively ... of intense resurfacing that resulted in the formation of ... polygonal-shaped regions called coronae. , These coronae are ... at least 200 km across. Arden corona, the largest, ...
(Date:9/18/2014)... University and the Quebec government have discovered microplastics ... Journal of Fisheries and Aquatic Sciences . , ... or industrial cleansers, to which they are commonly ... and buoyancy, they may readily pass through sewage ... in the world,s oceans, but have only recently ...
Breaking Biology News(10 mins):Researchers develop unique waste cleanup for rural areas 2Miranda: An icy moon deformed by tidal heating 2Miranda: An icy moon deformed by tidal heating 3Miranda: An icy moon deformed by tidal heating 4Miranda: An icy moon deformed by tidal heating 5Miranda: An icy moon deformed by tidal heating 6Miranda: An icy moon deformed by tidal heating 7Microplastic pollution discovered in St. Lawrence River sediments 2
... at the University of Minnesota have identified a ... disease begins as a respiratory tract infection, which ... then moves to the lungs, making superantigens (bacterial ... often leading to death due to hypertension and ...
... Outcomes Software (IOS) today,announced the release of ... the award-winning Gene Expression and Proteomics Analysis,Software ... importing and analyzing,protein biomarker data, a high ... we have integrated the Protein Biomarker Package ...
... A novel high-tech microscope will be brought to ... into living organisms. EMBLEM Technology Transfer GmbH (EMBLEM), ... Laboratory (EMBL), announced today that it has signed ... to commercialize a new technology called SPIM (Selective ...
Cached Biology News:U of M researcher examines newly emerging deadly disease 2Improved Outcomes Releases GeneLinker(TM) Gold and Platinum Version 4.6 2Improved Outcomes Releases GeneLinker(TM) Gold and Platinum Version 4.6 3The transparent organism: EMBLEM and Carl Zeiss give labs a unique look at life 2
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
...
... polyclonal antibody raised against a partial recombinant ... (AAH35357, 120 a.a. ~ 250 a.a) partial ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Biology Products: