Navigation Links
Dr. Ross Kaplan Offers New State-of-the-Art Wrinkle, Fine Line, and Skin Texture Improvement Treatment
Date:6/30/2012

(PRWEB) June 30, 2012

Camarillo area dermatologist Ross Kaplan, M.D. is proud to announce that his practice, Coastal Dermatology, now offers Sublative Rejuvenation™ treatments using the eMatrix™ device.

Sublative Rejuvenation using the eMatrix device is an FDA-cleared treatment that delivers targeted energy to the deeper layers of skin, without overheating the surface skin, allowing collagen stimulation without full surface ablation. The system utilizes Sublative RF™ – fractionated bi-polar radio frequency technology – to place the heat energy effectively into the dermis where it can produce significant dermal impact with minimal epidermal disruption. This avoids the significant downtime of other comparable treatments.

"Sublation treatments with the eMatrix have the immediate results of more invasive procedures, but without the downtime typically associated with those surgeries or other lasers," says Dr. Kaplan, "And because this treatment works to rebuild natural collagen, the results can last longer."

Improvements can be observed immediately after treatment, and typically continue for up to one year. Maintenance treatments after the first year can help to further enhance the rejuvenative effects of Sublation. Unlike other non-aggressive treatments such as Botox or fillers that also have immediate results, Sublative Rejuvenation with the eMatrix works from the inside out, stimulating cell growth deep within the skin.

Treatment of the entire face typically takes less than thirty minutes. Because sublation works by causing heat with bi-polar radio frequency and not applying a specific wavelength of laser energy, the eMatrix is also safe for use on all skin types and degrees of pigmentation.

Dr. Ross Kaplan is a board-certified dermatologist whose interest in cutting edge laser technology and therapy has made
'/>"/>

Source: PRWeb
Copyright©2012 Vocus, Inc.
All rights reserved

Page: 1 2

Related biology technology :

1. AMRESCO Offers New Prism Protein Marker With Vibrant Colors For Easy Band Identification
2. Salimetrics Offers New Saliva Collection Aid for Easy Collection of Passive Drool Samples
3. Berkshire Corporation Offers Live Chat For Americas Website and Shopping Cart
4. Tri-Valley Sedation Dentist Dr. Endre Selmeczy Now Offers High-quality Dental Restorations
5. Big Saver: Molderizer Offers 30% Mold Remediation Products Price Cut
6. Butamax Granted Core Patent for Making Biobutanol and Distillers Grains; Offers Producers Efficient, Low-Cost Production of Biobutanol
7. UH Case Medical Center Offers New Therapy for Gynecologic Cancer Patients
8. Gundersen Lutheran Offers Heart Surgery with Less Pain, Faster Recovery
9. Fortis Offers Bachelor of Science in Nursing Degree Program to Florida Students
10. Healthpoint Biotherapeutics To Create State-of-the-Art Cell Sciences Manufacturing Facility
11. State-of-the-Art Novelda NVA6000 Impulse Radar Transceiver Finds Widespread Appeal and Applications
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:9/19/2014)... YORK, September 18, 2014 Scientists at NYU Langone ... dramatically the efficiency of the process for turning adult ... well-known compounds, including vitamin C. Using the new technique ... cells obtained from adult skin cells by more than ... technique is efficient and reliable, and thus should generally ...
(Date:9/19/2014)... Sept. 19, 2014  Nektar Therapeutics (NASDAQ: ... studies characterizing the analgesic profiles of a series ... receptor agonist molecules. The preclinical research candidates were ... platform. The analgesic properties of kappa ... literature. 1,2 Kappa opioid receptors are expressed ...
(Date:9/19/2014)... -- Dublin ... the addition of the  "Micro Market Monitor : ...      (Logo: http://photos.prnewswire.com/prnh/20130307/600769) , , ,The ... segments in the chromatography market. The market was ... to reach $2.0 billion by 2019, at a ...
(Date:9/18/2014)... -- About POCT POCT, also ... laboratory. It helps in making fast clinical decisions, ... POCT is gaining popularity due to the increasing ... diabetes, heart disease, and obesity. It is generally ... minimize errors during the diagnosis of patients. POCT ...
Breaking Biology Technology:NYU Langone scientists report reliable and highly efficient method for making stem cells 2NYU Langone scientists report reliable and highly efficient method for making stem cells 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 2Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 4Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 5Micro Market Monitor : Global Pre-packed Chromatography Columns 2POCT Market in China 2014-2018 2
... , ... computational drug discovery solutions provider, announced today they have licensed ... Drug Administration,s National Center for Toxicological Research (NCTR). , Under ... access to the complete TIP structural knowledgebase via ...
... , NEW ORLEANS, Dec. 8 HemaQuest Pharmaceuticals presented data ... of its lead drug candidate, HQK-1001, in sickle cell disease ... Society of Hematology in New Orleans. The preclinical studies ... of therapeutic agents that have been used in the past ...
... ... Extended Wear Hearing Aid. , ... Newark, CA (PRWEB) December 8, 2009 -- Whether it’s a crackling fire, jingling sleigh bells, ... miss out on the joyous sounds of the holidays. Lyric, the first 100% invisible ...
Cached Biology Technology:Eidogen-Sertanty Licenses TIP to the FDA 2HemaQuest Pharmaceuticals Presents Promising Results in Sickle Cell Disease and Beta Thalassemia 2HemaQuest Pharmaceuticals Presents Promising Results in Sickle Cell Disease and Beta Thalassemia 3Lyric Presents the Sounds of the Season 2
(Date:9/18/2014)... and their colleagues have built the first smartphone ... performance and behavioral trends. In other words, your ... if you don,t -- and how that affects ... happiness, stress, depression and loneliness to their academic ... population for example, to monitor mental health, ...
(Date:9/18/2014)... celebrated tonight at the third annual Golden Goose Award ... premature infants and in paving the way for the ... supported by the National Science Foundation, the National Institutes ... be honored at a ceremony at the Library of ... of Congress will be on hand to help present ...
(Date:9/18/2014)... when people are too stressed they are often grouchy, ... Mind Institute (BMI) at EPFL have just highlighted a ... stress and the loss of social skills and cognitive ... synaptic regulatory molecule in the brain. This was revealed ... , Carmen Sandi,s team went to look for ...
Breaking Biology News(10 mins):New Dartmouth smartphone app reveals users' mental health, performance, behavior 2New Dartmouth smartphone app reveals users' mental health, performance, behavior 3New Dartmouth smartphone app reveals users' mental health, performance, behavior 43rd annual Golden Goose award ceremony honors 8 researchers; Unusual work had big results 2How stress tears us apart 2
... DNA is copied into ribonucleic acid (RNA) molecules, also ... making proteins, and a collection of all the transcripts ... Jaiswal, Assistant Professor of Botany and Plant Pathology at ... Jaiswal,s laboratory, and colleagues assembled transcriptomes of a noxious ...
... AMHERST, Mass. Biochemists at the University of Massachusetts ... insight into how protein synthesis and degradation help to ... they reveal how two proteins shelter each other in ... and safely. Cells must routinely dispose of leftover ...
... University of Florida paleontologists have discovered remarkably well-preserved fossils ... science during recent Panama Canal excavations that began in ... and an extinct hippo-like species inhabited Central America during ... expands the range of ancient animals in the subtropics ...
Cached Biology News:Assembling the transcriptome of a noxious weed: New resources for studying how plants invade 2New insight into double-protected dance of cell division 2UF scientists discover new crocodilian, hippo-like species from Panama 2UF scientists discover new crocodilian, hippo-like species from Panama 3
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
...
... polyclonal antibody raised against a partial recombinant ... (AAH35357, 120 a.a. ~ 250 a.a) partial ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Biology Products: