Navigation Links
Diagenode Introduces Innovative Bioruptor® Pico for Micro-Volume Chromatin and DNA Shearing
Date:4/4/2013

Denville, NJ (PRWEB) April 04, 2013

Diagenode, Inc., a leading global provider of complete solutions for epigenetics research today announced the launch of the Bioruptor® Pico, an innovative “all-in-one” sonication device for chromatin and DNA shearing. Diagenode’s Bioruptor® sonication devices use Adaptive Cavitation Technology (ACT) to create gentle, focused mechanical stress to shear biological samples in a temperature-controlled environment, highly effective for chromatin shearing, DNA & RNA shearing, cell lysis and tissue homogenization. The Bioruptor® is the most cited line of sonication devices with over 700 peer-reviewed publications.

The new Bioruptor® Pico represents a new breakthrough as an all-in-one shearing system optimized for shearing micro-volumes of 5 µl to larger volumes of up to 2 ml. This wide range enables a large variety of applications such as DNA shearing for next generation sequencing library preparation, RNA shearing, and chromatin shearing. It has been widely noted that shearing is a critical step in a number of applications. For example, the data accuracy from applications such as next generation sequencing library preparation, chromatin immunoprecipitation, and ChIP-seq depends on high-quality sample shearing and fragmentation.

"The Diagenode Bioruptor® Pico has been designed to provide the consistency, yields, and best range of fragment sizes, aspects that are critical for optimal sequencing library preparation such as in ChIP-seq and chromatin shearing” said Didier Allaer, CEO of Diagenode, “We remain committed to the epigenetics market, providing unique epigenetic solutions and innovating our line of shearing devices as the market requires increasingly smaller volumes for shearing.” In addition, the new instrument allows cost-effective shearing with sample multiplexing and simultaneous sonication of 6 to12 samples."

Manuela Saath
'/>"/>

Source: PRWeb
Copyright©2012 Vocus, Inc.
All rights reserved

Page: 1 2 3

Related biology technology :

1. Texas Fertility Center Introduces Oncofertility Education Program for Physicians and Patients
2. Finesse Solutions Introduces SmartParts for Intelligent Universal Controllers
3. Cearna Introduces Product Designed to Reduce Patient’s Recovery Time From Facial Plastic Surgery
4. Rigaku Introduces New Instruments at Pittcon 2013
5. GIN Introduces Advanced Robotics and Dispensing Technology at BVS La Jolla Biotech Day
6. FMC BioPolymer Introduces Its New Portfolio of Nature-Based Nutritional Solutions
7. Percival Scientific, Inc. Introduces an Affordable LED Lighting System for the Research Industry
8. Palomar Medical Center in San Diego County Introduces New Wrist-Worn Wireless Patient Vital Signs Device
9. Vista College Introduces Its New Medical Laboratory Technician Diploma Program At El Paso Campus
10. GLM Displays Introduces New Banner Stand – 10’ Tall “Giant Mosquito”
11. Rigaku introduces the world’s most comprehensive biological SAXS system for the home lab
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:11/24/2014)... -- Five American winners will receive the ... for Medical Sciences", in its 8 th term; ... , on 15 December 2014.      (Photo: ... Center which won the Hamdan Award for Volunteers in ... that aim to improve health and promote peace and ...
(Date:11/24/2014)... One of the most extensive, widely cited ... is now available to high school and junior college students ... the international society for optics and photonics , announced today ... Digital Library available to high schools for free and ... integral to all areas of life in today’s world,” said ...
(Date:11/24/2014)... , November 24, 2014 ... Workflow, honored for dynamic leadership skills, business acumen ... technical and medical information products and services, congratulates ... for Clinical Reference and Workflow, Elsevier Clinical Solutions, for ... Worth Watching ® Awards issue of Profiles ...
(Date:11/22/2014)... CannLabs, Inc. (OTCQB: CANL), ... scientific testing methodologies relating to cannabis, today announced that ... of credit from an existing stockholder of the Company. ... this commitment from one of our existing stockholders,” stated ... capital will help accelerate our planned expansions into the ...
Breaking Biology Technology:Five US Winners Among Recipients of Hamdan Medical Awards 2SPIE Digital Library Now Available to High Schools, Two-Year Colleges at No or Low Cost 2Elsevier Clinical Solutions' Diane Bartoli Featured In Profiles in Diversity Journal's 13th Annual Women Worth Watching Issue 2Elsevier Clinical Solutions' Diane Bartoli Featured In Profiles in Diversity Journal's 13th Annual Women Worth Watching Issue 3CannLabs Secures $750,000 Line Of Credit 2
... Laura G. Leff, Department of Biological Sciences, Kent State,University, Kent, Ohio , ... Introduction , Assessing bacterial genetic ... because of difficulties in culturing native bacteria and the large number , ... physiological , traits of most microbes are ...
... and Li Tian, PhD, Bio-Rad Laboratories, 2000 Alfred,Nobel Drive, Hercules, CA 94547 USA, ... The Benchmark Plus microplate reader is a new ... that offers superior convenience, accuracy, and flexibility. , ... , feature has been designed in Microplate ...
, , , , , , back to top...
Cached Biology Technology:Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 2Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 3Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 4Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 5Benchmark Plus Microplate Reader Scan Well Feature 2Benchmark Plus Microplate Reader Scan Well Feature 3
(Date:11/4/2014)... about the way our bodies are assembled during early ... they are supposed to become a nerve or a ... correct place and alignment? Researchers at the University of ... a new study, UM researchers describe the signaling systems ... at the head-trunk region. Their discovery may have important ...
(Date:11/4/2014)... , November 4, 2014   ... market growth   Fuel3D , a developer ... a funding round totaling $6.4 million (£4 million). This funding ... secured earlier this year and paves the way for the ... The funding round was led by Chimera Partners ...
(Date:11/4/2014)... , Nov. 4, 2014   Neurotechnology ... today announced that the latest version of its ... the Ongoing MINEX evaluation organized by ... fingerprint algorithms using the INCITS 378 fingerprint standard ... requirement in public tenders in the ...
Breaking Biology News(10 mins):The inside story: How the brain and skull stay together 2Fuel3D Secures $6.4 Million in Expansion Funding 2Fuel3D Secures $6.4 Million in Expansion Funding 3Neurotechnology Places Second in Ongoing MINEX Ranking for Fingerprint Matching Algorithms 2Neurotechnology Places Second in Ongoing MINEX Ranking for Fingerprint Matching Algorithms 3
... 9, 2009 Even small errors made by cells during protein ... ways to uncover these mistakes and correct them. Though in ... alaninenature has been extra careful, developing not one, but two ... is used correctly. Now, scientists at The Scripps ...
... to celebrate New Year,s Eve, drug industry executives will likely ... companies who make top-selling drugs for heart disease, asthma, and ... of mounting market pressures and a global recession. A timely ... scheduled for the current issue of Chemical & Engineering ...
... The University of Alabama used worms to reel in information ... cellular mechanisms that may be exploited to treat epilepsy. In ... ( http://www.genetics.org ), the researchers explain how the transparent roundworm, ... that control the transport of a molecule (gamma-aminobutyric acid or ...
Cached Biology News:Scripps Research team uncovers chemical basis for extra 'quality control' in protein production 2Scripps Research team uncovers chemical basis for extra 'quality control' in protein production 3Scripps Research team uncovers chemical basis for extra 'quality control' in protein production 4More than fish bait: Worms unlock secrets to new epilepsy treatments 2
... Staining Solution stains proteins in polyacrylamide ... limit >= 8 ng of protein) ... and destaining processes can be performed ... gel (20 min), proteins can be ...
Mouse monoclonal antibody raised against a partial recombinant PASK. NCBI Entrez Gene ID = PASK...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... antibody raised against a partial recombinant FES. ... 120 a.a. ~ 250 a.a) partial recombinant ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Accession Number: AAH35357 ...
Biology Products: