Navigation Links
Denser, more powerful computer chips possible with plasmonic lenses that 'fly'
Date:10/22/2008

researchers compared this flying plasmonic head to the arm and stylus of an LP turntable, with the photoresist surface spinning like a record. Instead of a needle moving along the grooves of a spinning record, however, the flying plasmonic head contains a nanometer-scale optical stylus that "writes" onto the spinning surface of the photoresist without actually touching it.

Because the light from plasmons decays less than 100 nanometers from the metal surface, the photoresist material must be placed very close to the lens. To accommodate this limitation, the researchers designed an air bearing that uses the aerodynamic lift force created by the spinning to help keep the two surfaces a mere 20 nanometers apart.

Air bearings are used to create magnetic tapes and disk drives, but this is the first application for a plasmonic lens.

With this innovative setup, the engineers demonstrated scanning speeds of 4 to 12 meters per second.

"The speed and distances we're talking about here are equivalent to a Boeing 747 flying 2 millimeters above the ground," added Zhang. "Moreover, this distance is kept constant, even when the surface is not perfectly flat."

The researchers pointed out that a typical photolithography tool used for chip manufacturing costs $20 million, and a set of lithography masks can run $1 million. One of the reasons for the great expense is the use of shorter light wavelengths to create higher resolution circuitry. Shorter wavelengths require nontraditional and costly mirrors and lenses.

The system described by the UC Berkeley engineers uses surface plasmons that have much shorter wavelengths than light, yet are excitable by typical ultraviolet light sources with much longer wavelengths. The researchers estimate that a lithography tool based upon their design could be developed at a small fraction of the cost of current lithography tools.

Other alternatives have been developed that can achieve hi
'/>"/>

Contact: Sarah Yang
scyang@berkeley.edu
510-643-7741
University of California - Berkeley
Source:Eurekalert  

Page: 1 2 3 4

Related biology technology :

1. The sensitive side of carbon nanotubes: Creating powerful pressure sensors
2. Move over, silicon: Advances pave way for powerful carbon-based electronics
3. Pharmaceutical Budget and Staffing: Powerful New Metrics-Based Study
4. Amnis Announces Release of Powerful New Image Data Analysis Software
5. CSCs Dr. Robert M. Wah Makes Top 10 in 50 Most Powerful Physician Executives List
6. Melting defects could lead to smaller, more powerful microchips
7. U.S. Pharmaceutical Budget and Staffing: Powerful New Metrics-Based Study
8. Simbionix Releases Powerful New Learning Management System With Enhanced True Assessment System(TM)
9. Aureus Pharma Releases AurPROFILER(R) - a New and Powerful Pharmacology Profiling Solution
10. Penn engineers design computer memory in nanoscale form that retrieves data 1,000 times faster
11. Penn engineers design computer memory in nanoscale form that retrieves data 1,000 times faster
Post Your Comments:
*Name:
*Comment:
*Email:
Related Image:
Denser, more powerful computer chips possible with plasmonic lenses that 'fly'
(Date:9/19/2014)... YORK, September 18, 2014 Scientists at NYU Langone ... dramatically the efficiency of the process for turning adult ... well-known compounds, including vitamin C. Using the new technique ... cells obtained from adult skin cells by more than ... technique is efficient and reliable, and thus should generally ...
(Date:9/19/2014)... Sept. 19, 2014  Nektar Therapeutics (NASDAQ: ... studies characterizing the analgesic profiles of a series ... receptor agonist molecules. The preclinical research candidates were ... platform. The analgesic properties of kappa ... literature. 1,2 Kappa opioid receptors are expressed ...
(Date:9/19/2014)... -- Dublin ... the addition of the  "Micro Market Monitor : ...      (Logo: http://photos.prnewswire.com/prnh/20130307/600769) , , ,The ... segments in the chromatography market. The market was ... to reach $2.0 billion by 2019, at a ...
(Date:9/18/2014)... -- About POCT POCT, also ... laboratory. It helps in making fast clinical decisions, ... POCT is gaining popularity due to the increasing ... diabetes, heart disease, and obesity. It is generally ... minimize errors during the diagnosis of patients. POCT ...
Breaking Biology Technology:NYU Langone scientists report reliable and highly efficient method for making stem cells 2NYU Langone scientists report reliable and highly efficient method for making stem cells 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 2Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 4Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 5Micro Market Monitor : Global Pre-packed Chromatography Columns 2POCT Market in China 2014-2018 2
... , ... computational drug discovery solutions provider, announced today they have licensed ... Drug Administration,s National Center for Toxicological Research (NCTR). , Under ... access to the complete TIP structural knowledgebase via ...
... , NEW ORLEANS, Dec. 8 HemaQuest Pharmaceuticals presented data ... of its lead drug candidate, HQK-1001, in sickle cell disease ... Society of Hematology in New Orleans. The preclinical studies ... of therapeutic agents that have been used in the past ...
... ... Extended Wear Hearing Aid. , ... Newark, CA (PRWEB) December 8, 2009 -- Whether it’s a crackling fire, jingling sleigh bells, ... miss out on the joyous sounds of the holidays. Lyric, the first 100% invisible ...
Cached Biology Technology:Eidogen-Sertanty Licenses TIP to the FDA 2HemaQuest Pharmaceuticals Presents Promising Results in Sickle Cell Disease and Beta Thalassemia 2HemaQuest Pharmaceuticals Presents Promising Results in Sickle Cell Disease and Beta Thalassemia 3Lyric Presents the Sounds of the Season 2
(Date:9/18/2014)... and their colleagues have built the first smartphone ... performance and behavioral trends. In other words, your ... if you don,t -- and how that affects ... happiness, stress, depression and loneliness to their academic ... population for example, to monitor mental health, ...
(Date:9/18/2014)... celebrated tonight at the third annual Golden Goose Award ... premature infants and in paving the way for the ... supported by the National Science Foundation, the National Institutes ... be honored at a ceremony at the Library of ... of Congress will be on hand to help present ...
(Date:9/18/2014)... when people are too stressed they are often grouchy, ... Mind Institute (BMI) at EPFL have just highlighted a ... stress and the loss of social skills and cognitive ... synaptic regulatory molecule in the brain. This was revealed ... , Carmen Sandi,s team went to look for ...
Breaking Biology News(10 mins):New Dartmouth smartphone app reveals users' mental health, performance, behavior 2New Dartmouth smartphone app reveals users' mental health, performance, behavior 3New Dartmouth smartphone app reveals users' mental health, performance, behavior 43rd annual Golden Goose award ceremony honors 8 researchers; Unusual work had big results 2How stress tears us apart 2
... DNA is copied into ribonucleic acid (RNA) molecules, also ... making proteins, and a collection of all the transcripts ... Jaiswal, Assistant Professor of Botany and Plant Pathology at ... Jaiswal,s laboratory, and colleagues assembled transcriptomes of a noxious ...
... AMHERST, Mass. Biochemists at the University of Massachusetts ... insight into how protein synthesis and degradation help to ... they reveal how two proteins shelter each other in ... and safely. Cells must routinely dispose of leftover ...
... University of Florida paleontologists have discovered remarkably well-preserved fossils ... science during recent Panama Canal excavations that began in ... and an extinct hippo-like species inhabited Central America during ... expands the range of ancient animals in the subtropics ...
Cached Biology News:Assembling the transcriptome of a noxious weed: New resources for studying how plants invade 2New insight into double-protected dance of cell division 2UF scientists discover new crocodilian, hippo-like species from Panama 2UF scientists discover new crocodilian, hippo-like species from Panama 3
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
...
... polyclonal antibody raised against a partial recombinant ... (AAH35357, 120 a.a. ~ 250 a.a) partial ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Biology Products: