Navigation Links
DATATRAK Recognized as 2011 Crain's Leading EDGE Award Winner
Date:5/23/2011

languages throughout the world. DATATRAK has offices located in Cleveland, Ohio; Bryan, Texas; and Cary (RTP), North Carolina. For more information, visit http://www.datatrak.net.

Except for the historical information contained in this press release, the statements made in this release are forward-looking statements. These forward-looking statements are made based on management's expectations, assumptions, estimates and current beliefs concerning the operations, future results and prospects of the Company and are subject to uncertainties and factors which are difficult to predict and, in many instances, are beyond the control of the Company, and which could cause actual results to differ materially from those contemplated in these forward-looking statements. For a list of certain of the factors that may cause actual results to differ materially from those contemplated in these forward looking statements, please see the Company’s quarterly report filed with the OTCQX Market on May 18, 2011 announcing its results for the three-month period ending March 31, 2011. The Company undertakes no obligation to update publicly or revise any forward-looking statement whether as a result of new information, future events or otherwise.


'/>"/>
SOURCE DATATRAK International, Inc.
Copyright©2010 PR Newswire.
All rights reserved

0

GOOD

Page: 1 2

Related biology technology :

1. DATATRAK International, Inc. Forms Strategic Partnership with Inclinix, Inc.
2. DATATRAK International, Inc. to Release 2009 Second Quarter and First-Half Operating Results on August 17, 2009
3. DATATRAK Signs New Client for Rescue Study
4. DATATRAK Exhibiting at the DIAs 46th Annual Meeting
5. DATATRAK Completes Sale of 357,857 Common Shares to Directors and Management
6. DAIICHI SANKYO EUROPE GmbH Selects DATATRAK eClinical™ for Pan-European Systolic Hypertension Study
7. DATATRAK International, Inc. Announces Initial Equity Research Coverage by Zacks Investment Research
8. DATATRAK Academy Expands to Include Durham Technical Community College
9. Ohio Recognized as National Leader for Business Development and Job Creation
10. MedNet Solutions Again Recognized as one of the Fastest Growing US Companies
11. Quintiles Recognized Among Best Companies to Work For in Brazil
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:6/18/2013)... WILMINGTON, Delaware , June 18, 2013 /PRNewswire/ ... to announce the release of the HELM biomolecular ... permissive open source MIT licence. HELM ... of a wide range of biomolecules (e.g. proteins, ... render existing small-molecule and sequence-based informatics methodologies impractical ...
(Date:6/18/2013)... -- The "Bioinformatics Market By Sector (Molecular Medicine, Agriculture, ... Data Analysis Services) & Application (Genomics, Proteomics & Drug Design) - Global ... Restraints, and Opportunities in North America , ... and Rest of World. Browse , ... Figures 364 Pages and an in-depth ...
(Date:6/18/2013)... , June 18, 2013 ... ) has announced the addition of the ... and Companies " to their offering. ... report briefly reviews basics of human genome ... applications. Current large and small sequencers are ...
(Date:6/18/2013)... DUBLIN , June 18, 2013 ... Markets ( http://www.researchandmarkets.com/research/cmbgcv/north_american ) has announced ... American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes ... Radiation Therapy (I131, Y-90)], [Applications (Cancer/Oncology, ... to 2017" report to their ...
Breaking Biology Technology:The Pistoia Alliance Releases HELM Biomolecular Representation Standard Open Source Tools 2Bioinformatics Market Worth $7.5 Billion by 2017 2Bioinformatics Market Worth $7.5 Billion by 2017 3DNA Sequencing: Technologies, Markets and Companies - 2013 Report 2North American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes Market - Forecast to 2017 2North American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes Market - Forecast to 2017 3
... ROCKVILLE, Md., July 21 Novavax, Inc. (Nasdaq: ... J. Trizzino as Senior Vice President, International and Government Alliances, ... directly to Dr. Rahul Singhvi, Novavax,s President and Chief Executive ... international alliances with pharmaceutical companies and all governmental agencies, including ...
... NEW YORK, July 21 /PRNewswire-Asia-FirstCall/ -- American ... Company" or "AOBO"), a pharmaceutical,company dedicated to improving ... broad range of prescription and over the counter ... honorably elected as one of,the "Top 20 Most ...
... , PALO ALTO, Calif., July 21, Varian, ... quarter of its fiscal year 2009 after 1:00 p.m. Pacific Time (PT) ... its investor conference call to review those quarterly results is scheduled to ... , That live webcast can be accessed from Varian, Inc.,s ...
Cached Biology Technology:Novavax Announces Appointment of John J. Trizzino as Senior Vice President, International and Government Alliances 2American Oriental Bioengineering Honorably Elected a Top 20 Most Competitive Public Pharmaceutical Company in China 2
(Date:6/18/2013)... It,s not a hacker lab. At Brandeis University, ... units are helping scientists understand the complex interplay ... of the virus, outer "shell" critical for ... of what we are finding will help researchers ... says post-doctoral fellow Jason Perlmutter, first author of ...
(Date:6/18/2013)... 2013: The Association for Molecular Pathology is proud to ... for Experimental Biology (FASEB) on July 1, 2013. The ... 3, 2013. , The 26 constituent societies of ... common vision for the advancement of research and education ... research is more important now than ever," said Jennifer ...
(Date:6/18/2013)... New research from the University of Adelaide shows that ... a baby,s life is linked to a higher IQ at early ... Public Health researchers, who analysed data from more than 13,800 children ... Pediatrics , show that babies who put on ... IQ 1.5 points higher by the time they were six years ...
Breaking Biology News(10 mins):Computer modeling technique goes viral at Brandeis 2IQ link to baby's weight gain in first month 2
... OAK RIDGE, Tenn., Sept. 9, 2010 -- Exemplary ... have resulted in a 2010 Federal Energy & Water ... Award in recognition of the lab,s Sustainable Campus Initiative. ... DOE,s Federal Energy Management Program recognized ORNL for its ...
... WI, SEPTEMBER 9, 2010 The American Society of ... 2010 Awards Ceremony on Nov. 2 during the scientific ... . The annual awards are presented for outstanding contributions ... research. , Alan Blaylock, Agrium Advanced Technologies ...
... New Rochelle, NY, September 9, 2010A subset of ... associated with more illness and greater allergic hypersensitivity, ... Blood, and Lung Institute,s Severe Asthma Research Program ... Pediatric Allergy, Immunology, and Pulmonology , a ...
Cached Biology News:ORNL wins 2 awards for sustainability program 2American Society of Agronomy announces award recipients 2American Society of Agronomy announces award recipients 3American Society of Agronomy announces award recipients 4Research and insights on severe asthma in children 2
... Mouse monoclonal antibody raised against a partial recombinant ... 56 a.a. ~ 145 a.a) partial recombinant protein ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
Mouse monoclonal antibody raised against a partial recombinant PRKG1. NCBI Entrez Gene ID = PRKG1...
... The user-friendly Eppendorf Thermomixer R offers ... that require shaking, heating, and cooling. ... expanded its application and temperature control ... each accommodate 24 micro test tubes, ...
...
Biology Products: