Navigation Links
Cyber Infrastructure Pvt. Ltd. (CIS) Begins Offering BOT (Build-Operate-Transfer) IT-Outsourcing Model for SMEs

Milpitas, California (PRWEB) May 02, 2013

Cyber Infrastructure Pvt. Ltd. (CIS), an outsourcing company based in Indore, India with over 500 employees and operating since 2003 has officially begun offering BOT (Build-Operate-Transfer) model to its clients. Over 50 established companies at CIS have already been operating under this model which allows companies to fully own and control their offshore operation.

CIS’s growth and deep knowledge in running an offshore dedicated center since 2003 has allowed it for the creation of a unique BOT model which emphasizes risk management for established companies wishing to set up their own captive software development center. Furthermore, Company’s strategic location in Madhya Pradesh, Indore becoming known as a catalyst for the growth.

Kuldeep Kundal, Director stated: “CIS’ seeing a huge number of talented professionals coming to Indore from metros such as Bangalore, Mumbai, Ahmedabad, Pune and so forth who are fed up with the cost of living in those metros. This has allowed the company to hire top tier professionals at a competitive advantage which has resulted in savings of over 40% for the clients.

The company is excited about its brand new 42,000 square feet office and infrastructure and feel it is the perfect time to begin offering its BOT model to SME’s. The company is hoping that its experience and understanding of SME’s around the globe will translate into the success of new BOT model service offering."

CIS’ BOT Model for IT Offshore Outsourcing
During the Build and Operate phases, Company's services are same as those given in its ODC (Offshore Dedicated Center) model. This basically means the client’s offshore operation runs fully within the company and it provides all assets, resources, and support services while still client retain complete freedom over operational control.

Later, the transfer moment is carefully pla

Source: PRWeb
Copyright©2012 Vocus, Inc.
All rights reserved

Page: 1 2 3

Related biology technology :

1. UMass Amherst, Harvard experts say better systems needed for medical device cybersecurity
2. Accuray Announces First CyberKnife System in South America
3. Centers for Medicare & Medicaid Services Win 2012 National Cybersecurity Innovation Award
4. UMBC Cybersecurity and Biotechnology Programs Hold April 24 Information Session at Shady Grove Campus
5. UPMC Invests in Intelligent Infrastructure with IBM to Support Vision of Personalized Medicine
6. INRS acquires a groundbreaking advanced imaging infrastructure
7. Remote Infrastructure Management Firm Nuware Wins a Major Contract in Singapore with a Life Sciences Organization
8. Kitware to Develop a Universal Healthcare Exchange Language Infrastructure
9. Aveka Nutra Processing proudly begins producing products from Z Trim Holdings, Inc.
10. PathoGenetix Adds Director of Manufacturing and Begins Production of New Rapid Bacterial Strain Typing System
11. Florida Tech Research Team Earns Competitive Grant, Begins ISS Mission Biology Experiment
Post Your Comments:
(Date:11/24/2014)... -- Five American winners will receive the ... for Medical Sciences", in its 8 th term; ... , on 15 December 2014.      (Photo: ... Center which won the Hamdan Award for Volunteers in ... that aim to improve health and promote peace and ...
(Date:11/24/2014)... One of the most extensive, widely cited ... is now available to high school and junior college students ... the international society for optics and photonics , announced today ... Digital Library available to high schools for free and ... integral to all areas of life in today’s world,” said ...
(Date:11/24/2014)... , November 24, 2014 ... Workflow, honored for dynamic leadership skills, business acumen ... technical and medical information products and services, congratulates ... for Clinical Reference and Workflow, Elsevier Clinical Solutions, for ... Worth Watching ® Awards issue of Profiles ...
(Date:11/22/2014)... CannLabs, Inc. (OTCQB: CANL), ... scientific testing methodologies relating to cannabis, today announced that ... of credit from an existing stockholder of the Company. ... this commitment from one of our existing stockholders,” stated ... capital will help accelerate our planned expansions into the ...
Breaking Biology Technology:Five US Winners Among Recipients of Hamdan Medical Awards 2SPIE Digital Library Now Available to High Schools, Two-Year Colleges at No or Low Cost 2Elsevier Clinical Solutions' Diane Bartoli Featured In Profiles in Diversity Journal's 13th Annual Women Worth Watching Issue 2Elsevier Clinical Solutions' Diane Bartoli Featured In Profiles in Diversity Journal's 13th Annual Women Worth Watching Issue 3CannLabs Secures $750,000 Line Of Credit 2
... Laura G. Leff, Department of Biological Sciences, Kent State,University, Kent, Ohio , ... Introduction , Assessing bacterial genetic ... because of difficulties in culturing native bacteria and the large number , ... physiological , traits of most microbes are ...
... and Li Tian, PhD, Bio-Rad Laboratories, 2000 Alfred,Nobel Drive, Hercules, CA 94547 USA, ... The Benchmark Plus microplate reader is a new ... that offers superior convenience, accuracy, and flexibility. , ... , feature has been designed in Microplate ...
, , , , , , back to top...
Cached Biology Technology:Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 2Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 3Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 4Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 5Benchmark Plus Microplate Reader Scan Well Feature 2Benchmark Plus Microplate Reader Scan Well Feature 3
(Date:11/4/2014)... about the way our bodies are assembled during early ... they are supposed to become a nerve or a ... correct place and alignment? Researchers at the University of ... a new study, UM researchers describe the signaling systems ... at the head-trunk region. Their discovery may have important ...
(Date:11/4/2014)... , November 4, 2014   ... market growth   Fuel3D , a developer ... a funding round totaling $6.4 million (£4 million). This funding ... secured earlier this year and paves the way for the ... The funding round was led by Chimera Partners ...
(Date:11/4/2014)... , Nov. 4, 2014   Neurotechnology ... today announced that the latest version of its ... the Ongoing MINEX evaluation organized by ... fingerprint algorithms using the INCITS 378 fingerprint standard ... requirement in public tenders in the ...
Breaking Biology News(10 mins):The inside story: How the brain and skull stay together 2Fuel3D Secures $6.4 Million in Expansion Funding 2Fuel3D Secures $6.4 Million in Expansion Funding 3Neurotechnology Places Second in Ongoing MINEX Ranking for Fingerprint Matching Algorithms 2Neurotechnology Places Second in Ongoing MINEX Ranking for Fingerprint Matching Algorithms 3
... 9, 2009 Even small errors made by cells during protein ... ways to uncover these mistakes and correct them. Though in ... alaninenature has been extra careful, developing not one, but two ... is used correctly. Now, scientists at The Scripps ...
... to celebrate New Year,s Eve, drug industry executives will likely ... companies who make top-selling drugs for heart disease, asthma, and ... of mounting market pressures and a global recession. A timely ... scheduled for the current issue of Chemical & Engineering ...
... The University of Alabama used worms to reel in information ... cellular mechanisms that may be exploited to treat epilepsy. In ... ( ), the researchers explain how the transparent roundworm, ... that control the transport of a molecule (gamma-aminobutyric acid or ...
Cached Biology News:Scripps Research team uncovers chemical basis for extra 'quality control' in protein production 2Scripps Research team uncovers chemical basis for extra 'quality control' in protein production 3Scripps Research team uncovers chemical basis for extra 'quality control' in protein production 4More than fish bait: Worms unlock secrets to new epilepsy treatments 2
... Staining Solution stains proteins in polyacrylamide ... limit >= 8 ng of protein) ... and destaining processes can be performed ... gel (20 min), proteins can be ...
Mouse monoclonal antibody raised against a partial recombinant PASK. NCBI Entrez Gene ID = PASK...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... antibody raised against a partial recombinant FES. ... 120 a.a. ~ 250 a.a) partial recombinant ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Accession Number: AAH35357 ...
Biology Products: