Navigation Links
Clinical Conductor CTMS Partners with the Greater Gift Initiative to Donate Vaccines
Date:10/24/2013

Winston-Salem, NC and Rochester, NT (PRWEB) October 24, 2013

The fall conference schedule for the Clinical Trial Industry is in full swing,and Clinical Conductor CTMS, the leading clinical trial management system for research organizations from Bio-Optronics, is actively participating in many events to talk and meet with clinical trial professionals about its family of clinical trial management systems. This year, Clinical Conductor is sharing booth space with the Greater Gift Initiative (GGI) and donating vaccines in honor of conference participants. “We are so appreciative of Clinical Conductor’s support of GGI and their donation of vaccines in honor of visitors to the booth,” says Becca Chase, Executive Director of GGI. “Talking with conference participants in the exhibit hall is a great opportunity to tell the GGI story and ultimately have more clinical trial sites honor their volunteers with the gift of a vaccine to a child in need.” Clinical Conductor donated vaccines on behalf of every attendee at the 2013 Site Solutions Summit held October 11-13 to recognize the Society for Clinical Research Sites (SCRS) for its commitment to helping clinical research sites reach their true potential. In addition to the donations made at the Site Solutions Summit, Clinical Conductor is donating vaccines in honor of participants who visit its booth at CenterWatch’s fall 2013 Forum on Optimizing Clinical Research Performance this week in Las Vegas, Nevada, and at the upcoming MAGI West Clinical Research Conference in Las Vegas on October 27-30. The vaccine donations are being made through the Greater Gift Initiative, whose mission is to advance global health and highlight the greater good of clinical trial participation by gifting a vaccine to a child in honor of every clinical trial volunteer. Vaccines were selected as the gift of choice because they have contributed to the improvement of global health more than any other class of pharmac
'/>"/>

Source: PRWeb
Copyright©2012 Vocus, Inc.
All rights reserved

Page: 1 2 3

Related biology technology :

1. ChemoCentryx Presents Positive Results for Novel CCR2 Inhibitor in Preclinical Models of Diabetic Nephropathy at the 44th Annual Meeting of the American Society of Nephrology
2. Positive Clinical Study Results for BSPs HyperQ Technology
3. DermTechs Non-invasive Melanoma Detection Assay Poised to Enter Clinical Validation Study
4. Nile Therapeutics Announces Top-Line Results in Clinical Trial Evaluating the Subcutaneous Infusion of Cenderitide, Meets Primary Endpoint
5. AtheroNova Inc. Preclinical Study Demonstrates 95% Reduction in Arterial Plaque Formation
6. A New Type of Dendritic Cell-Based Cancer Vaccine has Received Approval for Clinical Tests and at the Same Time Secures Substantial Financing
7. Generex Provides Update on Generex Oral-lyn™ Clinical & Regulatory Program
8. US Oncology Research Affiliated Physician to Present Findings From Innovative Clinical Trial at 2011 CTRC-AACR San Antonio Breast Cancer Symposium
9. TetraLogic Pharmaceuticals Announces Initiation of a Phase 1/2 Clinical Trial of TL32711 in Patients with Acute Myelogenous Leukemia (AML)
10. Echo Therapeutics Announces Positive Results of Clinical Trial of its Symphony® Transdermal Continuous Glucose Monitoring (tCGM) System in Patients With Type 1 and Type 2 Diabetes
11. Leading Investigator to Present Clinical Data on Generex Oral-lyn™ at International Diabetes Federation Meetings in Dubai
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:9/19/2014)... YORK, September 18, 2014 Scientists at NYU Langone ... dramatically the efficiency of the process for turning adult ... well-known compounds, including vitamin C. Using the new technique ... cells obtained from adult skin cells by more than ... technique is efficient and reliable, and thus should generally ...
(Date:9/19/2014)... Sept. 19, 2014  Nektar Therapeutics (NASDAQ: ... studies characterizing the analgesic profiles of a series ... receptor agonist molecules. The preclinical research candidates were ... platform. The analgesic properties of kappa ... literature. 1,2 Kappa opioid receptors are expressed ...
(Date:9/19/2014)... -- Dublin ... the addition of the  "Micro Market Monitor : ...      (Logo: http://photos.prnewswire.com/prnh/20130307/600769) , , ,The ... segments in the chromatography market. The market was ... to reach $2.0 billion by 2019, at a ...
(Date:9/18/2014)... -- About POCT POCT, also ... laboratory. It helps in making fast clinical decisions, ... POCT is gaining popularity due to the increasing ... diabetes, heart disease, and obesity. It is generally ... minimize errors during the diagnosis of patients. POCT ...
Breaking Biology Technology:NYU Langone scientists report reliable and highly efficient method for making stem cells 2NYU Langone scientists report reliable and highly efficient method for making stem cells 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 2Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 4Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 5Micro Market Monitor : Global Pre-packed Chromatography Columns 2POCT Market in China 2014-2018 2
... Workshop Set for Sept. 3, UPPSALA, Sweden and ... Bernard de Bruyne, M.D., Ph.D., will present the,benefits of ... the outcomes of multivessel PCI in a workshop at ... The EBAC-accredited,workshop, which is sponsored by Radi Medical Systems, ...
... Cepheid (Nasdaq:,CPHD) will present at the Thomas Weisel ... Hotel, Boston, September 5 to 7, 2007. Chief,Executive ... Finance and,Chief Financial Officer, John R. Sluis will ... The webcast, along with accompanying presentation slides, may ...
... Verenium,Corporation (Nasdaq: VRNM ), a leading developer of ... high-performance specialty,enzymes, announced today that Carlos A. Riva, President ... the Cowen and Company Clean,Energy Conference. The presentation is ... 6, 2007 and will take place at Le Parker ...
Cached Biology Technology:Interventional Cardiologists Nico Pijls, Bernard De Bruyne to Discuss Benefits of Measuring Coronary Pressure in Improving Multivessel PCI at ESC Congress 2007 2Cepheid to Present at Thomas Weisel Partners Healthcare Conference 2Verenium Corporation to Present at the Upcoming Cowen and Company Clean Energy Conference 2Verenium Corporation to Present at the Upcoming Cowen and Company Clean Energy Conference 3
(Date:9/18/2014)... rabbitfish which have devastated algal forests in the eastern ... Mediterranean basin if their distribution continues to expand as ... by an international team of researchers led by Dr ... of the Mediterranean Institute for Advanced Studies in Spain, ... Members of the team surveyed more than 1000 kilometres ...
(Date:9/18/2014)... the ultimate form of camouflage: you don,t just blend ... is not as uncommon as you might think. Kathryn ... explains that the larval life stages of many marine ... the anatomy that most creatures cannot make transparent. Feller ... shield each individual eye unit with an opaque pigment ...
(Date:9/17/2014)... for the Arts and Humanities has received a $260,000 ... two-year project, "The Boundaries of the Human in the ... support a wide-ranging series of events aimed at exploring ... involves artists and researchers who are exploring the boundaries ... of humanism, and the other involves the increasingly influential ...
Breaking Biology News(10 mins):Tropical fish a threat to Mediterranean Sea ecosystems 2Transparent larvae hide opaque eyes behind reflections 2Mellon Foundation awards grant for major project in the humanities and sciences 2
... the immune system, a line of genetically engineered mice can ... of Medicine in St. Louis have found. , Scientists ... system component, a group of molecules known as the Major ... that is similar enough to step in and fill the ...
... to exist and even thrive in surroundings ranging from ... from the Weizmann Institute's Plant Sciences Department, led by ... just two amino acids (the building blocks of protein) ... temperatures and being adapted to living in extreme heat. ...
... has found that large segments of the Pacific Ocean ... the absence of the mineral stresses these microscopic ocean ... ocean productivity appear more robust than it really is. ... data may be inaccurate, the researchers say, and the ...
Cached Biology News:Mice lacking key immune component still control chronic viral infections 2Mice lacking key immune component still control chronic viral infections 3Bacteria beat the heat 2Iron critical to ocean productivity, carbon uptake 2Iron critical to ocean productivity, carbon uptake 3
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
...
... polyclonal antibody raised against a partial recombinant ... (AAH35357, 120 a.a. ~ 250 a.a) partial ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Biology Products: