Navigation Links
Circulating Tumor Cells (CTCs) and Cancer Stem Cells (CSCs) Market Report 2013
Date:11/27/2013

haracterization of the CTCs and CSCs landscape is a hands-on document that can be used for competitive benchmarking, business planning, and strategy developmentall the data that have been collected in this industry analysis are presented and they form the basis for the conclusions drawn throughout the market report presented in a format enabling drag-and-drop into business presentations/business plansthis Market Report is written and delivered to customers in Microsoft PowerPoint format.

Extensive Technical and Market Analyses Presented in this Report

- Molecular Characterization of CTCs and CSCs
- Technologies for Studying CTCs
- CTC Analysis Workflow
- Enrichment and Analysis Methodologies
- Details of Selected Approaches for circulating tumor cells Enumeration and Analysis
- Name of Company/Institution
- Microfluidics-based Approaches
- Imaging-based Approaches
- CTC and CSC Research Market Landscape
- Bottom-up Market Survey Data: Qualitative and Quantitative Market Analysis
- Product Vendors and their Penetrance into the Research Market
- Methodologies for Studying CTCs and CSCs
- Markers for Characterizing CTCs and CSCs
- Downstream Analyses on Captured CTCs
- CTC Quantitative Market Metrics
- Revenues from Clinical UtilizationMarket Size, Market Forecast, Growth Rate
- Analysis of Clinical Utility of CTCs
- Evidence for Biomarker Utility of CTCs
- CTC and CSC Clinical Trials Analysis

For more information visit http://www.researchandmarkets.com/research/vv9ntz/circulating_tumor

About Research and Markets

Research and Markets is the world's leading source for international market research reports and market data. We provide you with the latest data on international
'/>"/>

SOURCE Research and Markets
Copyright©2012 PR Newswire.
All rights reserved

Page: 1 2 3

Related biology technology :

1. Global Industry Analysts, Inc. Announces the Launch of a Major Research Program Analysing the Global Market for Circulating Tumor Cells and Cancer Stem Cells
2. Growing Industry in Technologies For Circulating Tumor Cells: Kalorama Report
3. PolyScience Performance Programmable Circulating Baths Deliver Ultra-Precise, Highly Customizable Performance
4. Discovery of Circulating Protein Biomarkers by Analysis of the Tissue Secretome, New Life Science Webinar Hosted by Xtalks
5. Blood-Based Circulating Microvesicles (cMV) Data to be Presented at the 2013 International Society for Extracellular Vesicles (ISEV)
6. PolyScience Heated Circulating Baths Boast Temperature Stabilities as Precise as ±0.005°C
7. Circulating Tumor Cells (CTCs) and Cancer Stem Cells (CSCs) Market is Expected to Reach USD 7.9 billion by 2018: Transparency Market Research
8. Biocept and Academic Collaborators to Present Posters at San Antonio Breast Cancer Symposium on Circulating Tumor Cells (CTCs)
9. Berg Launches First-Ever Stratified Medicine Clinical Trial To Investigate Cancer Metabolism Of Solid Tumors
10. National Brain Tumor Society Announces the Defeat GBM Research Collaborative’s Project Plans and Investigator Teams
11. Quantitative Profiling of the Intrinsic Pathway of Apoptosis in Tumor Tissue Using Myriad RBM’s Multiplex ApoptosisMAP™, a New Biomarker Webinar by Xtalks
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:11/18/2014)... (PRWEB) November 18, 2014 Brothers Josh ... the launch of PAWSitively Curing Cancer, Inc . ... new 501(c) (3) non-profit organization is dedicated to raising ... goes directly to the University of Florida College ... with PAWSitively Curing Cancer as the recipient of this ...
(Date:11/18/2014)... 2014  Great Basin Scientific, Inc. (NASDAQ: GBSN ... will host a conference call and webcast to provide an ... Nov. 20, at 4:30 pm EST time. "We ... Company,s recent IPO and would like to provide our investors ... Ryan Ashton , President and Chief Executive Officer of Great ...
(Date:11/16/2014)... 2014 James Hill and Ken Crooks ... Hoods, 3 Years Later” scheduled for Thursday, November 20, ... Butler University surprised many in the lab design domain ... chemistry and general chemistry teaching laboratories at Gallahue Hall. ... age and substantial growth within the chemistry program. Now, ...
(Date:11/15/2014)... Denver, Colorado (PRWEB) November 14, 2014 ... leading provider of proprietary, cloud-based analytics, and scientific ... results for the third quarter ended September 30, ... Quarter 2014 Highlights, ,     CannLabs – ... in Las Vegas, Nevada. ,     CannLabs – ...
Breaking Biology Technology:PAWSitively Curing Cancer, Inc. Launched By Two Children for National Pet Cancer Awareness Month 2PAWSitively Curing Cancer, Inc. Launched By Two Children for National Pet Cancer Awareness Month 3Great Basin Scientific Announces Conference Call to Provide Update on Corporate Progress 2Don't miss the I2SL High-Tech Talks Webinar Series Presenting: Butler University's Renovation With Filtered Fume Hoods, 3 Years Later 2Don't miss the I2SL High-Tech Talks Webinar Series Presenting: Butler University's Renovation With Filtered Fume Hoods, 3 Years Later 3CannLabs Announces Third Quarter 2014 Results. 2CannLabs Announces Third Quarter 2014 Results. 3CannLabs Announces Third Quarter 2014 Results. 4CannLabs Announces Third Quarter 2014 Results. 5
... president of Niceware International , a Milwaukee developer ... Matter has seen identification software used to track parts ... only a matter of time before healthcare facilities came ... founded in 2002, has produced NiceLabel software for the ...
... - In a criminal trial, as any fan of TV ... defense goes second. The accused can appear in deep trouble, at ... often carries the day. , ,Not only does that make for ... works in real life. Those who file the charges speak first, ...
... Milwaukee, Wis . - Midwest Fiber Networks , which ... by March of 2008, has been granted a reprieve by ... the project. , ,The council has voted to give Midwest ... or demonstration area, of the citywide wireless network. The company ...
Cached Biology Technology:Software company enters health space with RFID solutions on hold 2Software company enters health space with RFID solutions on hold 3Here's why Wisconsin's stem cell patents are being challenged 2Here's why Wisconsin's stem cell patents are being challenged 3Here's why Wisconsin's stem cell patents are being challenged 4
(Date:11/5/2014)... has dedicated his career to understanding the Earth,s ... audience. , As deputy director and regional climatologist ... Desert Research Institute, Redmond has more than three ... dissemination of climate data to the general public. ... San Francisco on December 15-19, 2014 the American ...
(Date:11/4/2014)... School of Medicine announced today that it is ... by the Bill & Melinda Gates Foundation. ... and Reproductive Sciences; and Vice Chair of Research ... Medicine will pursue an innovative global health and ... Assess Fetal Neurodevelopment.", Grand Challenges Explorations (GCE) funds ...
(Date:11/4/2014)... – (Nov. 4, 2014) – A majority of Madagascar,s ... that could have serious consequences for the rainforests they ... shows the positive impacts lemurs can have on rainforest ... their disappearance could have on the region,s rich biodiversity. ... have fruits eaten by lemurs. Lemurs in turn ...
Breaking Biology News(10 mins):Nevada climatologist to be honored at AGU Fall Meeting for lifetime of public outreach 2Temple University School of Medicine receives Grand Challenges Explorations grant 2Gardeners of Madagascar rainforest at risk 2Gardeners of Madagascar rainforest at risk 3
... microbiologist James Holden of the University of Massachusetts Amherst launches ... the cracks and thermal vents around an undersea volcano, for ... will not be funded by a government source. ... oceanographic research: The Gordon and Betty Moore Foundation started by ...
... YORK , Aug. 16, 2013   EyeLock Inc. , a market ... Roger An as Vice President of Global Market ... research, analysis and strategic initiatives to further the embedded applications ... heavy focus on Asia .   ...
... CITY)If terrorists targeted the United States with an anthrax attack, ... such as knowing the likelihood of an individual becoming ... and how long to give antibiotics to protect people ... anthrax-laced letters killed five people and infected 17 others in ...
Cached Biology News:Google, Intel founders support undersea research by UMass Amherst microbiologist 2Google, Intel founders support undersea research by UMass Amherst microbiologist 3EyeLock Appoints Roger An Vice President of Global Market Development 2EyeLock Appoints Roger An Vice President of Global Market Development 3Answering crucial questions about anthrax exposure 2Answering crucial questions about anthrax exposure 3Answering crucial questions about anthrax exposure 4
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
...
... polyclonal antibody raised against a partial recombinant ... (AAH35357, 120 a.a. ~ 250 a.a) partial ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Mouse monoclonal antibody raised against a partial recombinant PRKG1. NCBI Entrez Gene ID = PRKG1...
Biology Products: