Navigation Links
Breakthrough in sensing at the nanoscale
Date:9/1/2013

ted by both insufficient signal strength and interference from background noise. The special optical fibre engineered at IPAS also proved useful in understanding the properties of nanoparticles. "Material scientists have faced a huge challenge in increasing the brightness of nanocrystals," says Dr. Jin, ARC Fellow at Macquarie University's Advanced Cytometry Laboratories. "Using these optical fibres, however, we have been given unprecedented insight into the light emissions. Now, thousands of emitters can be incorporated into a single SuperDot creating a far brighter, and more easily detectable nanocrystal."

Under infrared illumination, these SuperDots selectively produce bright blue, red and infrared light, with a staggering thousand times more sensitivity than existing materials. "Neither the glass of the optical fibre nor other background biological molecules respond to infrared, so that removed the background signal issue. By exciting these SuperDots we were able to lower the detection limit to the ultimate level a single nanoparticle," says Jin.

"The trans-disciplinary research from multiple institutions has paved the way for this innovative discovery," says Jin, "with the interface of experts in nanomaterials, photonics engineering, and biomolecular frontiers."

"These joint efforts will ultimately benefit patients around the world - for example, our industry partners Minomic International Ltd and Patrys Ltd are developing uses for SuperDots in cancer diagnostic kits, detecting incredibly low numbers of biomarkers within conditions like prostate and multiple myeloma cancer." Macquarie is now actively seeking other industrial partners with the capacity to jointly develop solutions outside of these fields.


'/>"/>

Contact: Tanya Monro
tanya.monro@adelaide.edu.au
61-400-649-369
University of Adelaide
Source:Eurekalert

Page: 1 2

Related biology technology :

1. Memory breakthrough could bring faster computing, smaller memory devices and lower power consumption
2. Lawrence Livermore engineering team makes breakthrough in solar energy research
3. CEM Introduces New Breakthrough Technology for Microwave Peptide Synthesis
4. Andain Inc. Announces 2,000 Units Initial Production of the Breakthrough Miniature Disposable Insulin Pump for Use in Clinical Trials for Type-I and Type-II Diabetes
5. Big multiple sclerosis breakthrough
6. Breakthrough for IVF?
7. Breakthroughs with Martin Sheen Exploring Environmental Cleanup In New Report
8. U of T engineering breakthrough promises significantly more efficient solar cells
9. Quantum Cures Announces Breakthrough Approach for Researchers Seeking Cures for Orphan and Rare Diseases
10. New fabrication technique could provide breakthrough for solar energy systems
11. Art Levinson, Sergey Brin and Anne Wojcicki, Mark Zuckerberg and Priscilla Chan, and Yuri Milner Announce the Breakthrough Prize in Life Sciences
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:9/19/2014)... YORK, September 18, 2014 Scientists at NYU Langone ... dramatically the efficiency of the process for turning adult ... well-known compounds, including vitamin C. Using the new technique ... cells obtained from adult skin cells by more than ... technique is efficient and reliable, and thus should generally ...
(Date:9/19/2014)... Sept. 19, 2014  Nektar Therapeutics (NASDAQ: ... studies characterizing the analgesic profiles of a series ... receptor agonist molecules. The preclinical research candidates were ... platform. The analgesic properties of kappa ... literature. 1,2 Kappa opioid receptors are expressed ...
(Date:9/19/2014)... -- Dublin ... the addition of the  "Micro Market Monitor : ...      (Logo: http://photos.prnewswire.com/prnh/20130307/600769) , , ,The ... segments in the chromatography market. The market was ... to reach $2.0 billion by 2019, at a ...
(Date:9/18/2014)... -- About POCT POCT, also ... laboratory. It helps in making fast clinical decisions, ... POCT is gaining popularity due to the increasing ... diabetes, heart disease, and obesity. It is generally ... minimize errors during the diagnosis of patients. POCT ...
Breaking Biology Technology:NYU Langone scientists report reliable and highly efficient method for making stem cells 2NYU Langone scientists report reliable and highly efficient method for making stem cells 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 2Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 4Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 5Micro Market Monitor : Global Pre-packed Chromatography Columns 2POCT Market in China 2014-2018 2
... Andrea Armani and Ellis Meng, Both from Viterbi ... at MIT in September , , LOS ... Southern California today announced that two faculty members from the USC ... magazine as some of the world,s top innovators under the ...
... , ... announced that its Oragene®•DNA product has been selected by Prometheus as the sample collection ... for this type of genetic testing service as it solves sample collection challenges inherent ... ...
... PRINCETON, N.J., Aug. 18 Laureate Pharma, Inc., a ... of Joel A. Tune as a new member of its Board ... http://www.newscom.com/cgi-bin/prnh/20080131/N E TH020LOGO ) , ... focused on Laureate,s contract manufacturing business, Mr. Tune brings to Laureate ...
Cached Biology Technology:Two University of Southern California Innovators Recognized by Technology Review's Prestigious TR35 Listing of the World's Top Young Innovators for 2009 2Two University of Southern California Innovators Recognized by Technology Review's Prestigious TR35 Listing of the World's Top Young Innovators for 2009 3Two University of Southern California Innovators Recognized by Technology Review's Prestigious TR35 Listing of the World's Top Young Innovators for 2009 4Two University of Southern California Innovators Recognized by Technology Review's Prestigious TR35 Listing of the World's Top Young Innovators for 2009 5DNA Genotek Sample Collection Kit Selected by Prometheus for MyCeliacID™ Genetic Test 2DNA Genotek Sample Collection Kit Selected by Prometheus for MyCeliacID™ Genetic Test 3Laureate Pharma Elects New Board Member 2
(Date:9/18/2014)... - Washington State University researchers have developed a unique ... power waste cleanup in rural areas. , The ... an inexpensive and quick way to clean up waste ... while reducing pollution. , Professor Haluk Beyenal and ... Engineering and Architecture discuss the system in the online ...
(Date:9/18/2014)... Colo., USA Miranda, a small, icy moon of ... enigmatic bodies in the solar system. Despite its relatively ... of intense resurfacing that resulted in the formation of ... polygonal-shaped regions called coronae. , These coronae are ... at least 200 km across. Arden corona, the largest, ...
(Date:9/18/2014)... University and the Quebec government have discovered microplastics ... Journal of Fisheries and Aquatic Sciences . , ... or industrial cleansers, to which they are commonly ... and buoyancy, they may readily pass through sewage ... in the world,s oceans, but have only recently ...
Breaking Biology News(10 mins):Researchers develop unique waste cleanup for rural areas 2Miranda: An icy moon deformed by tidal heating 2Miranda: An icy moon deformed by tidal heating 3Miranda: An icy moon deformed by tidal heating 4Miranda: An icy moon deformed by tidal heating 5Miranda: An icy moon deformed by tidal heating 6Miranda: An icy moon deformed by tidal heating 7Microplastic pollution discovered in St. Lawrence River sediments 2
... at the University of Minnesota have identified a ... disease begins as a respiratory tract infection, which ... then moves to the lungs, making superantigens (bacterial ... often leading to death due to hypertension and ...
... Outcomes Software (IOS) today,announced the release of ... the award-winning Gene Expression and Proteomics Analysis,Software ... importing and analyzing,protein biomarker data, a high ... we have integrated the Protein Biomarker Package ...
... A novel high-tech microscope will be brought to ... into living organisms. EMBLEM Technology Transfer GmbH (EMBLEM), ... Laboratory (EMBL), announced today that it has signed ... to commercialize a new technology called SPIM (Selective ...
Cached Biology News:U of M researcher examines newly emerging deadly disease 2Improved Outcomes Releases GeneLinker(TM) Gold and Platinum Version 4.6 2Improved Outcomes Releases GeneLinker(TM) Gold and Platinum Version 4.6 3The transparent organism: EMBLEM and Carl Zeiss give labs a unique look at life 2
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
...
... polyclonal antibody raised against a partial recombinant ... (AAH35357, 120 a.a. ~ 250 a.a) partial ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Biology Products: