Navigation Links
Brain Fitness Program Offers Hope for Breast Cancer Survivors Suffering From 'Chemobrain'
Date:10/24/2008

4% of participants experienced positive changes in their overall well-being and reported statistically significant improvements in cognitive function, stress level and health-related quality of life.

Sueann Mark, PhD, was a study participant. "When I began the training, I couldn't remember appointments, where I put things and I had trouble finding the right word," she said. Dr. Mark said she started to notice changes after using the program for just a couple of weeks. "My attention span was getting longer. I could read through entire articles that a couple of weeks ago I couldn't get through. Knowing that I was exercising my mind and reactivating it was really comforting to me."

"While further studies are needed, the implications for improved brain health in cancer patients look promising," said lead researcher, Sarah-Jane Kim. "It's a practical approach to improving the quality of life in cancer patients because it is non-invasive and therefore, does not require additional medication and does not interfere with the cancer treatment."

About Posit Science

Posit Science is the leading provider of clinically validated brain health products and services. The company works with more than 50 scientists from prestigious universities to design and test its computer-based programs. More than 30 published studies show that the company's patented technologies significantly increase processing speed, improve memory, and enhance the quality of everyday life. Posit Science has received numerous grants and awards from groups such as the National Institutes of Health (NIH), the American Society for Aging (ASA), and CNBC.

For more information visit http://www.positscience.com


'/>"/>
SOURCE Posit Science
Copyright©2008 PR Newswire.
All rights reserved

Page: 1 2

Related biology technology :

1. The human brain minimizes energy expenditure and integrates gravity in to the action plan
2. MedTechIQ Selects TheBrain to Visualize Expansive Biointellingence Database and Connect the Dots Between Life Sciences, Medicine and Venture Capital
3. Scientists restore movement to paralyzed limbs through artificial brain-muscle connections
4. Brain and Hearing Pioneer, Michael Merzenich, Ph.D. to Speak at Case Western Reserve University
5. Swedish in Seattle Unveils State-of-the-Art Brain Tumor Center Combining Advanced Treatment With Innovation in Research
6. Swedish Neuroscience Institute and Institute for Systems Biology in Seattle Form Alliance to Learn More about Brain Diseases
7. Delaware Man Spearheads Brain Tumor Awareness
8. OmniGuide Introduces The BeamPath Neuro(TM): A CO2 Laser Fiber for Brain And Spine Surgery
9. Revealing the regulating mechanism behind signal transduction in the brain
10. Brain Cancer Patients at Two Leading Hospitals Treated Using Fast and Efficient RapidArc Radiotherapy Technology from Varian Medical Systems
11. Towards zero training for brain-computer interfacing
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:12/17/2014)... December 16, 2014 The Activated ... 2013, which is why IBISWorld updated its original industry ... to benefit from an intensified focus on environmental policy. ... new emission standards for power plants and a range ... to IBISWorld Industry Analyst Sarah Kahn, “a range of ...
(Date:12/17/2014)... Washington, USA (PRWEB) December 16, 2014 ... Baum, manager at Philipps- Universität Marburg’s Department of ... and photonics, in the newly released SPIE ... “And never be too shy to ask questions.” ... (science, technology, engineering, and mathematics) occupations ranging from ...
(Date:12/17/2014)... December 17, 2014 Ipsen Biopharmaceuticals, ... IPN; ADR: IPSEY), today announced that ... as Somatuline®) was approved by the U.S. Food ... gastroenteropancreatic neuroendocrine tumors (GEP-NETs) in adult patients with ... metastatic disease to improve progression-free survival (PFS). , ...
(Date:12/17/2014)... This report is a professional ... For an overview analysis, the report introduces quartz ... structure, industry overview, policy analysis, and news analysis, ... has witnessed rapid development with key manufacturers increasing ... report mentions quartz tubing upstream raw materials and ...
Breaking Biology Technology:Activated Carbon Manufacturing in the US Industry Market Research Report Has Been Updated from IBISWorld 2Activated Carbon Manufacturing in the US Industry Market Research Report Has Been Updated from IBISWorld 3Network, Multitask, Persevere: SPIE Women in Optics Planner Subjects Share from Experience 2Network, Multitask, Persevere: SPIE Women in Optics Planner Subjects Share from Experience 3Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 2Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 3Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 4Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 5Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 6Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 7Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 82020 Quartz Tubing Market: Global Development & Forecasts Analysis Now at DeepResearchReports.com 2
... BioMed Realty Trust, Inc. (NYSE: BMR ), a real ... Science Industry®, today announced financial results for the third quarter ended ... Generated record total revenues for the third quarter of ... in 2009. Increased rental revenues for the third quarter by ...
... to develop relatively advanced tools after their brains evolved a ... that investigates why it took early humans almost two million ... axe. Researchers used computer modelling and tiny sensors embedded ... humans needed in order to make two types of tools ...
... New Mexico, NOVEMBER 3, 2010Scientists at the U.S. Department ... Laboratory have fabricated transparent thin films capable of absorbing ... area. The material, described in the journal Chemistry ... transparent solar panels. "Potentially, with future refinement of ...
Cached Biology Technology:BioMed Realty Trust Reports Third Quarter 2010 Financial Results 2BioMed Realty Trust Reports Third Quarter 2010 Financial Results 3BioMed Realty Trust Reports Third Quarter 2010 Financial Results 4BioMed Realty Trust Reports Third Quarter 2010 Financial Results 5BioMed Realty Trust Reports Third Quarter 2010 Financial Results 6BioMed Realty Trust Reports Third Quarter 2010 Financial Results 7BioMed Realty Trust Reports Third Quarter 2010 Financial Results 8BioMed Realty Trust Reports Third Quarter 2010 Financial Results 9BioMed Realty Trust Reports Third Quarter 2010 Financial Results 10BioMed Realty Trust Reports Third Quarter 2010 Financial Results 11BioMed Realty Trust Reports Third Quarter 2010 Financial Results 12BioMed Realty Trust Reports Third Quarter 2010 Financial Results 13BioMed Realty Trust Reports Third Quarter 2010 Financial Results 14BioMed Realty Trust Reports Third Quarter 2010 Financial Results 15BioMed Realty Trust Reports Third Quarter 2010 Financial Results 16BioMed Realty Trust Reports Third Quarter 2010 Financial Results 17Stone Age humans needed more brain power to make big leap in tool design 2Scientists produce transparent, light-harvesting material 2
(Date:12/11/2014)... 2014  Data Sciences International (DSI), the global ... new series of digital telemetry implants to meet ... series, part of the PhysioTel™ Digital platform, was ... physiologic data when incorporating functional endpoints into repeat-dose ... toxicology studies has evolved from short ECG strips ...
(Date:12/10/2014)... DIEGO , Dec. 9, 2014 CIE ... collaboration catalyst that provides the connective tissue that enhances ... enabling them to easily share client-level information; earned a ... to expand to organizations serving seniors aging in community ... Diego" partner on December 11 th 4-6p. ...
(Date:12/5/2014)... , Dec. 4, 2014  Tute Genomics, a leader ... million in Series A1 funding led by UK-based Eurovestech. ... participated in the investment round. "We are ... community adopts next-generation sequencing and seeks new approaches for ... Reid Robison , MD MBA, and CEO of Tute ...
Breaking Biology News(10 mins):New telemetry implants expected to change how large animal toxicology studies are conducted 2Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 2Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 3Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 4Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 2Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 3
... You don,t need to spray weedkiller to remove the ... with either boiling water, steam or flaming will dispatch even ... a new PhD project from the University of Copenhagen. ... is important that each treatment is dosed correctly. Basically, ...
... Johns Hopkins scientists have engineered cells that behave like ... on one or more unique inputs. This feat, published in ... eventually help researchers create computers that use cells as tiny ... in the Department of Cell Biology and member of the ...
... BETHESDA, MD May 30, 2012 The Genetics Society ... six graduate students and seven postdoctoral researchers as recipients of ... Each of these early-career geneticists receives a $1,000 travel award ... in a laboratory course of their choice that will enhance ...
Cached Biology News:Blanch your weeds 2Training cells to perform Boolean functions? It's logical 2Training cells to perform Boolean functions? It's logical 3The Genetics Society of America announces DeLill Nasser Travel Award recipients 2
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
... kit contains sufficient materials for 1,464 array sample elements. ... 4 each , Blocker BSA in PBS (10X): ... , BupH Phosphate Buffered Saline: 8 packs ... SuperSignal West Pico Luminol Enhancer: 2 x 25 ml ...
Biology Products: