Navigation Links
Biotech & Life Sciences Hiring in Southern California on the Rise
Date:9/4/2013

DENVER, Sept. 4, 2013 /PRNewswire/ -- Today BioSpace, the largest online source for biotech and life sciences jobs, recruitment solutions and news, released its Biotech Beach Salary & Hiring Report, examining hiring trends, salary figures and more for the San Diego and Southern California areas.

(Logo: http://photos.prnewswire.com/prnh/20040907/CLTU006LOGO )

The number of employers posting jobs in the Biotech Beach region increased 31 percent in the last year, reflecting the Bureau of Labor Statistics' prediction that biopharmaceutical and medical device manufacturing jobs will increase 10 percent this decade.

"Biotech Beach continues to grow and job seekers will likely notice the increase in job postings," said Emily Chereck, BioSpace Product Manager. "Employers in this industry will see applications from many qualified candidates, as competition rises for biotech and life sciences positions."

The report details the state of life sciences/biotechnology careers in Southern California, including top jobs, salary information and the most in-demand positions – Scientist, Quality Assurance/Quality Control/Regulatory Affairs, Research Associate and Senior Scientist.

For more than a decade, BioSpace has highlighted the life sciences/biotech industry in San Diego and Southern California with the

SOURCE BioSpace
Copyright©2012 PR Newswire.
All rights reserved

Page: 1 2

Related biology technology :

1. Mendel Biotechnology to sell its subsidiary, Mendel Plant Sciences
2. Biotech Firms Announce Financial Results, Resignations, Reintroduce Treatments and Receive Reviews on Key Products - Research Report on Insmed, ImmunoGen, VIVUS, Theravance, and XOMA
3. Commercial Biotechnology Separation Systems Market Analyzed in New Research Report at ReportsnReports.com
4. The Zacks Analyst Blog Highlights: SPDR Health Care Select Sector Fund, SPDR S&P 500, SPDRS&P Biotech ETF, PowerShares S&P SmallCap Health Care Portfolio and PowerShares Dynamic Biotechnology & Genome Portfolio
5. Worldwide Marine Biotech Market 2016
6. Global Scenario, Trends, Industry Analysis, Size, Share And Forecast, 2012-2016 Report Available Online by Researchmoz.us
7. Public Offerings of Common Stock, Financial Results, and Significant Progress in Key Development Programs - Research Report on BioCryst, Exelixis, Idenix, Puma Biotechnology, and Halozyme
8. Sanguine BioSciences Announces Distribution Partnership with AMS Biotechnology
9. The BioTechniques 30th Anniversary Lecture Announced as Part of the 2013 BioTechniques Virtual Symposium
10. Midwest Biotech Leaders Featured On BioSpace Map
11. Biotech & BioPharma Professionals: CA Board of Pharmacy Executive, Virginia Herold, to Deliver Keynote at BSMA Annual Biotechnology Conference Oct 8-9
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:5/21/2015)... 2015 W. R. Grace & ... in Worms, Germany has received good manufacturing practice ... the International Pharmaceutical Excipient Council (IPEC) Foundation. ... its SYLOID® FP brand of pharmaceutical grade excipient ... the Curtis Bay, Maryland (USA) and Sorocaba, Brazil ...
(Date:5/21/2015)... 2015 Research and Markets ( ... "2015 Global Survey on Flow Cytometry Adoption ... The primary goal of this research is to ... reagents. Key information the survey seeks to collect ... cytometers, predominantly used applications for flow cytometers, respondents, ...
(Date:5/20/2015)... , May 20, 2015 Veracyte, ... preliminary data demonstrating the ability of the company,s ... (IPF) from other interstitial lung diseases (ILDs) using ... classifier,s potential to help thousands of patients avoid ... in IPF diagnosis – a frequent challenge for ...
(Date:5/20/2015)... Pa. , May 20, 2015  Select ... that the Federal Trade Commission granted early termination ... Antitrust Improvements Act of 1976, as amended, applicable ... MJ Acquisition Corporation, a joint venture that Select ... L.P. As previously announced, MJ Acquisition ...
Breaking Biology Technology:Grace European Facility Receives GMP Excipient Certification for SYLOID® FP Silica Gel 2Global Survey on Flow Cytometry Adoption Trends 2015 2Veracyte Presents Preliminary Data Demonstrating Ability of Molecular Classifier to Improve Non-Surgical IPF Diagnosis Using Bronchoscopy Samples 2Veracyte Presents Preliminary Data Demonstrating Ability of Molecular Classifier to Improve Non-Surgical IPF Diagnosis Using Bronchoscopy Samples 3Veracyte Presents Preliminary Data Demonstrating Ability of Molecular Classifier to Improve Non-Surgical IPF Diagnosis Using Bronchoscopy Samples 4Veracyte Presents Preliminary Data Demonstrating Ability of Molecular Classifier to Improve Non-Surgical IPF Diagnosis Using Bronchoscopy Samples 5Select Medical Corporation's Proposed Acquisition of Concentra Inc. through Joint Venture with Welsh Carson Receives Antitrust Clearance 2
... global,specialty biopharmaceutical company announces results for the year to,December 31, 2008 - a year which has seen significant ... ... Q4 2008 (1), Product sales ... 27% $0.70 bn + 7%(3), Product sales, ...
... NEWARK, Del., Feb. 19 Lightwave Logic, Inc. (OTC ... technology company focused on the development of electro-optic polymer ... optical computing, announced today the addition of Anthony J. ... for 30 years in medicinal chemistry and brings a ...
... most widely used drugs, is also one of the trickiest ... risk of serious problems when given the standard starting dose. ... medicine" based on genetic information, an international research team has ... of the blood-thinning drug for each patient. , Three ...
Cached Biology Technology:Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 2Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 3Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 4Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 5Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 6Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 7Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 8Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 9Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 10Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 11Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 12Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 13Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 14Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 15Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 16Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 17Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 18Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 19Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 20Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 21Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 22Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 23Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 24Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 25Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 26Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 27Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 28Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 29Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 30Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 31Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 32Shire Delivers Excellent Growth for the Year, With the new Product Portfolio Achieving Sales of $1 Billion 33Lightwave Logic, Inc. Announces the Addition of Anthony J. Cocuzza, PhD to its Technology Team 2Genetic information personalizes warfarin prescribing 2Genetic information personalizes warfarin prescribing 3
(Date:5/19/2015)... , May 19, 2015 ... has announced the addition of the  "Genetic ... offering.  ,     (Logo: http://photos.prnewswire.com/prnh/20130307/600769) , ,A recent ... an in-depth analysis of the current and ... of gene-based tests, their working principles and ...
(Date:5/14/2015)... NEW YORK , May 14, 2015 ... specializing in identity verification and online remote ... Instructure, a software-as-a-service (SaaS) company and creator ... Shared customers of the two companies will ... Proctortrack in Canvas. As a ...
(Date:5/11/2015)... Curemark LLC, a privately held drug research ... Phase III double blind, randomized, placebo-controlled clinical trial to ... all children ages 3-8 with Autism. Previously, Curemark announced ... blinded clinical trial for CM-AT in children ages 3-8 ... enzyme chymotrypsin. This new trial will help determine whether ...
Breaking Biology News(10 mins):Global Genetic Testing Market Outlook 2018 2Verificient and Instructure Announce Alliance Partnership to Provide Online Proctoring for K-12 and Higher Education Institutions 2Curemark, LLC, Launches New Phase III Trial in Expanded Population of Children with Autism 2
... care laws to protect patients, privacy make it nearly ... the safety and usability of medical products by observing ... usability errors and hazards may be overlooked, with the ... Ergonomics in Design, human factors/ergonomics researchers found ...
... between chemicals called phthalates and thyroid hormone levels was ... large-scale and nationally representative study of phthalates and BPA ... The U-M School of Public Health study also reported ... a chemical called bisphenol-A and thyroid hormone levels. BPA ...
... sources of social and emotional support for "everyday people," not ... by the American Psychological Association. And, the study ... in their lives as to their animals, indicating no evidence ... with other people, or that people relied more on pets ...
Cached Biology News:Large human study links phthalates, BPA and thyroid hormone levels 2The truth about cats and dogs: Pets are good for mental health of 'everyday people' 2
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... Mouse polyclonal antibody raised against a partial ... FES (AAH35357, 120 a.a. ~ 250 a.a) ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
... antibody raised against a partial ... Immunogen: PPP4C (NP_002711, 218 ... recombinant protein with GST tag. ... NM_002720 ...
Mouse monoclonal antibody raised against a partial recombinant CAPG. NCBI Entrez Gene ID = CAPG...
Biology Products: