Navigation Links
Apexigen and Shanghai Duyiwei Biotechnology Co. Ltd Sign a License and Collaboration Agreement to Develop and Commercialize APX004
Date:3/7/2012

yiwei. Based on its efforts, flexible mode of R&D and the continually increased investment on R&D, Duyiwei has the confidence and determination to constantly launch a series of original products in the near future to bring hope to the diseased and improve their quality of living," said Dr. Zhiping Duan, CEO of Gansu Duyiwei.

About Apexigen, Inc.

Apexigen, Inc. is an emerging biopharmaceutical company focused on the development of best-in-class antibody therapeutics for the treatment of cancer and other serious diseases.  Apexigen has a robust antibody platform technology and a pipeline of seven humanized antibody product candidates.  Apexigen's proprietary antibody technologies produce a broad diversity of antibodies with high specificity and high affinity against unique epitopes.  It can successfully generate antibodies against challenging antigens where competing technologies fail.  This technology allows Apexigen to identify antibodies with unique functional characteristics for optimal therapeutic benefit.

Developing its product pipeline through collaborations is an important aspect of Apexigen's business model.  Several antibodies derived from its technology have been licensed to companies in China who are developing them for commercialization there.  In addition, Apexigen has also licensed the use of its antibody technologies to multinational companies for use in the development of therapeutics worldwide.  Additional information is available at www.apexigen.com.

About Gansu Duyiwei Biological Pharmaceutical Co., Ltd.

Gansu Duyiwei Biological Pharmaceutical Co., Ltd. is located in Kang County, Longnan city , Gansu Province. As the first pharmaceutical company listed on Shenzhen Stock Exchange in Gansu Province, the company has developed very fast in recent years.

As an important Chinese patent medicine and crude drug company
'/>"/>

SOURCE Apexigen, Inc.
Copyright©2010 PR Newswire.
All rights reserved

0

GOOD

Page: 1 2 3

Related biology technology :

1. Apexigen Announces the Filing by its Partner, Simcere Pharmaceutical Group, of First IND
2. Carna Biosciences Signs Distribution Agreement with Shanghai Universal Biotech Company
3. Cynvec to Present at the 11th Annual Shanghai International Forum on Biotechnology and Pharmaceutical Industry
4. NeoStem Signs Agreement with Shanghai Corporation to Develop A Stem Cell Collection and Treatment Network in Shanghai, Taiwan and Other Targeted China Provinces
5. Sundia and 2 Other CRO Companies Granted Express Customs Clearance Privilege in Shanghai
6. Shanghai ChemPartner and Agios Expand Integrated Drug Discovery Research Collaboration
7. Sundia Shortens CRO Shipment Delivery Time with Express Customs Clearance in Shanghai
8. Shanghai ChemPartner and ELARA Pharmaceuticals Expand Drug Discovery Collaboration to a New Level
9. Pharma and Biotech Leaders to Converge in Shanghai
10. Biostar Pharmaceuticals, Inc. to Launch Xin Aoxing Oleanolic Acid Capsules in Beijing and Shanghai
11. Shanghai ChemPartner Ranks 3rd among 2009 Deloitte Technology Fast 50 China Winning Companies
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:6/18/2013)... FL (PRWEB) June 18, 2013 The human ... the skin as an important human body part. Similar to ... for in order to function, repair and grow. Recent reports ... vitamins and supplements, is just as important as other life ... supplements to aid in skin cell reproduction, increase the appearance ...
(Date:6/18/2013)... , June 18, 2013 ... release of the HELM biomolecular representation standard software ... MIT licence. HELM (Hierarchical Editing Language ... range of biomolecules (e.g. proteins, nucleotides, antibody drug ... and sequence-based informatics methodologies impractical or unusable. HELM ...
(Date:6/18/2013)... The "Bioinformatics Market By Sector (Molecular Medicine, Agriculture, Research ... Analysis Services) & Application (Genomics, Proteomics & Drug Design) - Global Forecasts ... and Opportunities in North America , ... Rest of World. Browse , ... 364 Pages and an in-depth Table ...
(Date:6/18/2013)... 2013 Research and ... addition of the report " DNA Sequencing ... their offering.      (Logo: http://photos.prnewswire.com/prnh/20130307/600769) ... of human genome variations, development of sequencing ... small sequencers are described as well as ...
Breaking Biology Technology:Natural Acne Remedies Through Diet, Probiotic Action Shares New Insight on What Foods May Help Lead to Clear Skin 2The Pistoia Alliance Releases HELM Biomolecular Representation Standard Open Source Tools 2Bioinformatics Market Worth $7.5 Billion by 2017 2Bioinformatics Market Worth $7.5 Billion by 2017 3DNA Sequencing: Technologies, Markets and Companies - 2013 Report 2
... that allow nanoparticles to assemble themselves into designer materials ... of Iowa State University and the Ames Laboratory reports ... Science . Travesset, an associate professor of physics ... of Energy,s Ames Laboratory, writes in the journal,s Perspectives ...
... today announced that Jeff Liter has been appointed as ... "Jeff,s diverse background in all aspects of corporate development ... Said Matt McManus, President and CEO, PrimeraDx.  "PrimeraDx,s strategy ... Plex system in the MDx market and define ...
... from the Faculty of Biology and Biotechnology at the ... of Biological Chemistry explaining why enzymes used for ... In collaboration with researchers from Berlin, they used spectroscopic ... that lead to the inactivation of the enzyme,s iron ...
Cached Biology Technology:Iowa State, Ames Lab physicist says nanoparticle assembly is like building with LEGOs 2PrimeraDx Appoints Jeff Liter as VP of Corporate Development 2If oxygen becomes the undoing of proteins 2
(Date:6/18/2013)... Kingdom, the Energy Department,s National Renewable Energy Laboratory ... published a paper describing a novel cellulose-degrading enzyme ... , commonly known as the gribble. , ... relatively unique ability to produce their own enzymes ... the biomass they eat. New biomass-degrading enzymes from ...
(Date:6/18/2013)... not a hacker lab. At Brandeis University, sophisticated ... are helping scientists understand the complex interplay between ... the virus, outer "shell" critical for replication. ... what we are finding will help researchers alter ... post-doctoral fellow Jason Perlmutter, first author of the ...
(Date:6/18/2013)... Torrent, Ph.D., Medical Research Council, Laboratory of Molecular ... a 2013 ICAAC Young Investigator Award. Torrent is ... developing the first algorithm to predict antimicrobial regions ... said, "we are now applying this algorithm to ... antimicrobial peptide leads with very appealing results." ...
Breaking Biology News(10 mins):Novel enzyme from tiny gribble could prove a boon for biofuels research 2Computer modeling technique goes viral at Brandeis 2The American Society for Microbiology honors Marc Torrent 2
... could help ships sailing smoothly. The growth of marine ... major cause of increased energy costs in the naval ... this so called 'bio-fouling'. , Ralph Liedert from the ... work on the application of artificial shark skin in ...
... that provides a vital passage through a bacterium's outer ... is built of the 'wrong' material, scientists at The ... a finding that has long-term implications for understanding diseases ... disease, and mad cow disease. , The paper in ...
... of different items by scanning the tiny barcode printed ... could make it just as easy to identify genes, ... tagging them with color-coded probes made out of synthetic ... Luo, Cornell assistant professor of biological engineering, has created ...
Cached Biology News:Beyond genes: Lipid helps cell wall protein fold into proper shape 2Beyond genes: Lipid helps cell wall protein fold into proper shape 3Tagging pathogens with synthetic DNA 'barcodes' 2Tagging pathogens with synthetic DNA 'barcodes' 3
... Mouse monoclonal antibody raised against a partial recombinant ... 56 a.a. ~ 145 a.a) partial recombinant protein ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
Mouse monoclonal antibody raised against a partial recombinant PRKG1. NCBI Entrez Gene ID = PRKG1...
... The user-friendly Eppendorf Thermomixer R offers ... that require shaking, heating, and cooling. ... expanded its application and temperature control ... each accommodate 24 micro test tubes, ...
...
Biology Products: